KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_2818Help
Entry
BURPS1710b_2818   CDS       T00289                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00860  Porphyrin and chlorophyll metabolism
bpm01100  Metabolic pathways
bpm01110  Biosynthesis of secondary metabolites
Module
bpm_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BURPS1710b_2818 (hemN)
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     BURPS1710b_2818 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HemN_C Radical_SAM TonB_2
Motif
Other DBs
NCBI-ProteinID: ABA48054
UniProt: Q3JQF1
Position
I:complement(3129163..3130608)
Genome map
AA seq 481 aa AA seqDB search
MTTQSNDGADTTAPAPQHDVSAFADVQISEALIRRFDRQGPRYTSYPTADRFSDAFDERA
YREHLSRRASAERNPPLSVYLHLPFCESLCYFCACNKIITQDHTRTSAYVDYLIREMELV
APDLGRDRRTTQLHLGGGSPTFFAIDELARLMRALREHFDFAPHAELGVEIDPRTVNERT
LQSLAALGFNRTSFGVQDFDPSVQEAVHRIQPLPMVERALEASRAAGFESVNIDLIYGLP
RQTPASFSRTLDEVIRLSPERIAVYNYAHLPSRFKAQRLIVEAQLPPAEDRLRIFIESTR
RLLDAGYVYIGLDHFAKPNDELGNALRERSLHRNFQGYTTQAECDLVGFGVSAIGKVGAS
YSQSTRSLKTYYRQLDAGRLPIERGFALTADDLLRREVIMTVMCSTPVDFAEISHRHGID
FARYFAPELAQLEPYRDAGLLTIDAQRIAVTPKGRMFVRAIGMVFDAYLGRSAAASYSKL
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgcaatcgaacgacggcgcggatacgaccgcgcccgctccccaacacgacgtg
tccgcgttcgcggacgttcagatctccgaagcgctgattcggcgcttcgaccggcaaggg
ccgcgctatacgtcctatccgacggccgaccggttctccgacgcattcgacgagcgcgcg
taccgcgaacatctgtcgcgccgcgcgtcagccgagcgtaatccgccgctgtcggtctat
ctgcatctgccgttttgcgagtcgctctgctacttctgcgcgtgcaacaagatcatcacg
caggatcacacccgcacgagcgcgtacgtcgactatctgatccgcgaaatggagctcgtc
gcgccggatctcggccgcgatcggcggacgacgcaactgcatctgggcggcggctcgccg
acgttcttcgcgatcgacgagctcgcgcgcctgatgcgcgcgctgcgcgagcacttcgac
ttcgcgccgcacgcggagctcggcgtcgagatcgatccgcgcacggtcaacgagcgcacc
ctgcagtcgctcgcggcgctcggcttcaaccggacgagcttcggcgtgcaggacttcgat
ccgtcggtgcaggaggcggtgcatcggatccagccgctgccgatggtcgagcgcgcgctc
gaggcgagccgcgcggccggtttcgaatcggtcaacatcgatctgatctacgggttgccg
cggcagacgcccgcgagcttttcgcgcacgctcgacgaggtgatccggctgtcgcccgag
cgcatcgcggtctacaactacgcgcatttgccgagccgcttcaaggcgcagcgcctgatc
gtcgaagcgcagctgccgcccgcggaagaccggctgcggatcttcatcgaatcgacgcgg
cggctgctcgacgcgggctacgtgtacatcgggctcgatcacttcgcgaagccgaacgac
gagctcggcaacgcgctgcgcgagcgcagcctgcaccgcaatttccagggctatacgacg
caggccgaatgcgatctcgtcggcttcggcgtatcggcgatcggcaaggtcggcgcctcg
tacagccagtcgacgcgctcgctgaagacctattaccgccagctcgacgcggggcgcctg
ccgatcgagcggggcttcgcgctgacagccgacgatttgctgcgccgcgaagtcatcatg
acggtgatgtgcagcacacccgtcgatttcgcggagatcagccacaggcacggcatcgat
ttcgcccggtatttcgcgcccgagctcgcgcagctcgagccgtatcgcgacgcggggctg
ctcacgatcgatgcgcagcgcatcgccgtcacgccgaaggggcgcatgttcgtgcgcgcg
atcggcatggtgttcgacgcgtatctcggccgcagcgccgcggcgtcttattcgaaattg
atctag

DBGET integrated database retrieval system