KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_3143Help
Entry
BURPS1710b_3143   CDS       T00289                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase family protein
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00010  Glycolysis / Gluconeogenesis
bpm00030  Pentose phosphate pathway
bpm00051  Fructose and mannose metabolism
bpm00052  Galactose metabolism
bpm00230  Purine metabolism
bpm00500  Starch and sucrose metabolism
bpm00520  Amino sugar and nucleotide sugar metabolism
bpm00521  Streptomycin biosynthesis
bpm01100  Metabolic pathways
bpm01110  Biosynthesis of secondary metabolites
bpm01120  Microbial metabolism in diverse environments
bpm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1710b_3143
   00030 Pentose phosphate pathway
    BURPS1710b_3143
   00051 Fructose and mannose metabolism
    BURPS1710b_3143
   00052 Galactose metabolism
    BURPS1710b_3143
   00500 Starch and sucrose metabolism
    BURPS1710b_3143
   00520 Amino sugar and nucleotide sugar metabolism
    BURPS1710b_3143
  Nucleotide metabolism
   00230 Purine metabolism
    BURPS1710b_3143
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BURPS1710b_3143
Enzymes [BR:bpm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BURPS1710b_3143
    5.4.2.8  phosphomannomutase
     BURPS1710b_3143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABA49674
UniProt: Q3JPI8
Position
I:complement(3448046..3449440)
Genome map
AA seq 464 aa AA seqDB search
MISQSIFKAYDIRGVIGKTLDADVARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELVGA
LADGLRAAGVDVVDVGMVPTPVGYFAASVPLALSGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGDQIQGLYKRIVDARFETGNGSYERYDVADQYVERIVGDIRLARPLKLVVDA
GNGVAGPLATRLFKALGCELVELFTDIDGNFPNHHPDPAHPENLQDVIAKLKTTDAEIGF
AFDGDGDRLGVVTKDGQIVYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRNLAQWVREKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILARAADP
SALLNGLPNAVSTPELQLKLDEGENVKLIDKLRADAKFDGADEVVTIDGLRVEYPDGFGL
ARSSNTTPVVVLRFEASSDAALARIQDDFRRALKAAKPDANLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctcccaatccatcttcaaggcatacgatattcggggcgtgatcggcaagacgctc
gacgccgacgtcgcgcgctcgatcggccgcgcattcggcagcgaagtgcgcgcgcagggc
ggcgacgcggtcgtcgtcgcgcgcgacggccggctctcggggcccgagctcgtcggcgcg
ctcgcggacgggctgcgcgcggcgggcgtcgatgtcgtcgacgtcggcatggtgccgacg
cccgtcggctacttcgcggcgagcgtgccgctcgcgctgtcgggcggcgagcgccgcgtc
gattcgtgcatcgtcgtcacgggcagccacaatccgcccgactacaacggtttcaagatg
gtcctgcgcggcgccgcgatttacggcgaccagatccagggcctgtacaagcgcatcgtc
gacgcgcgtttcgagaccggcaacggttcgtatgagcgatacgatgtcgccgatcaatac
gtcgagcgcatcgtcggcgacatcaggctcgcgcggccgctgaagctcgtcgtcgatgcg
ggcaacggcgtcgcgggcccgctcgcgacgcgcctgttcaaggcgctcggctgcgaactc
gtcgagctcttcaccgacatcgacggcaacttcccgaaccaccacccggacccggcgcac
ccggagaacctgcaggacgtgatcgcgaagctgaagacgaccgatgccgagatcggcttc
gcgttcgacggcgacggcgaccgcctcggcgtcgtcacgaaggacggccagatcgtctat
ccggaccgccagctgatgctgttcgccgaggaagtgctgtcgcgcaacccgggcgcgcag
atcatctacgacgtgaagtgcacgcgcaatctcgcgcagtgggtgcgcgagaagggcggc
gagccgctgatgtggaagacgggccactcgctcgtgaaggcgaagctgcgcgagacgggc
gcgccgctcgcgggcgagatgagcggccacgtgttcttcaaggatcgctggtacggcttc
gacgacggcctctacacgggcgcgcgcctgctcgagatcctcgcgcgcgcggccgatccg
agcgcgctgctcaacggcttgccgaacgcggtgtcgacgcccgagctgcaattgaagctc
gacgaaggcgagaacgtgaagctgatcgacaagctgcgcgccgacgcgaagttcgacggc
gcggacgaggtcgtgacgatcgacggtctgcgcgtcgagtatccggacggcttcggtctc
gcgcgttcgtcgaacacgacgcccgtggtcgtgctgcgcttcgaggcgagctccgacgcg
gcgctcgcgcggatccaggacgatttccggcgcgcgctgaaggcggcgaagccggacgcg
aacctgccgttctga

DBGET integrated database retrieval system