KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_3635
Entry
BURPS1710b_3635   CDS       T00289                                 

Definition
(GenBank) OmpA family domain protein
  KO
K03286  OmpA-OmpF porin, OOP family
Organism
bpm  Burkholderia pseudomallei 1710b
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpm02000]
    BURPS1710b_3635
Transporters [BR:bpm02000]
 Other transporters
  Pores ion channels [TC:1]
   BURPS1710b_3635
SSDB
Motif
Pfam: OmpA Pilus_CpaD BON FinO_N
Other DBs
NCBI-ProteinID: ABA48571
UniProt: Q3JN53
Position
I:3960172..3961104
AA seq 310 aa
MTKPRLPLLRARRFALAFAALALGGAARADNVGPATVTPIDAGGVPVKSVPLAAPVTAAP
VAATAGAGATVSSPPPANATPGQVVAGGKVADEATKAAVLQRLRDTYGAANVVDQIEIGN
VATPPNWSANVQKLIGPQLKQISKGQLKIDGTQIDVKGEVHNEAQRQQLASDMANALNPT
YTIKNGLRVSASEQGLLDQTLANRTIEFETGSATLTPQGRAILDQMAGALAKMSSRTVEI
IGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTTTGVGPDQPIAPNDSADGRAR
NRRIEFRAGQ
NT seq 933 nt   +upstreamnt  +downstreamnt
atgacgaagccccgcctgcccctgctgcgcgcccgccgcttcgcgctcgcgttcgccgcg
ctcgcgctcggcggcgccgcgcgcgccgacaacgtcggccccgccaccgtcacgccgatc
gacgccggcggcgtgcccgtcaaatcggtgccgctcgccgcgcccgtgacggccgcgccg
gtcgccgcgacggccggcgcgggcgcgaccgtgtcgtcgccgccgcccgcgaacgcgacg
ccgggccaggtcgtcgccggcggcaaggttgccgacgaagcgacgaaggccgccgtgctg
cagcgcctgcgcgacacgtacggcgccgcgaacgtcgtcgaccagatcgaaatcggcaac
gtcgcgacgccgccgaactggtccgcgaacgtccagaagctgatcggcccgcaactgaaa
cagatcagcaaaggacagctgaagatcgacggcacgcagatcgacgtgaagggcgaagtg
cacaacgaggcgcagcgccagcagctcgcgagcgacatggcgaacgcgctgaatccgacc
tacacgatcaagaacgggctgcgcgtgagcgcgtccgagcagggcctgctcgaccagacg
ctcgcgaaccgcacgatcgaattcgaaaccggcagcgcgacgctcacgccgcaaggccgc
gcgattctcgaccagatggcgggcgcgctcgcgaagatgtcgagccgaacggtcgagatc
atcgggcacaccgacaactcgggcaaccgcacgtcgaacatcgcgctcagccaggcgcgc
gcggacgcggtcaagggatatctggtgacgaagggcatcgcgtcgcagcaactgacgacg
acgggtgtcggccccgatcagccgatcgcgccgaacgattcggccgacgggcgcgcgcgc
aatcgccggatcgaattccgcgcgggacagtaa

DBGET integrated database retrieval system