KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_3636
Entry
BURPS1710b_3636   CDS       T00289                                 

Definition
(GenBank) Uncharacterized protein conserved in bacteria
  KO
K11902  type VI secretion system protein ImpA
Organism
bpm  Burkholderia pseudomallei 1710b
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpm02044]
    BURPS1710b_3636
Secretion system [BR:bpm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1710b_3636
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: ABA49688
UniProt: Q3JN52
Position
I:complement(3961303..3962424)
AA seq 373 aa
MPTNLTELLTPISEASPCGDDLLFSAEFDAIQHARKFDDPSLDQGEWITDIKEADWGFVV
EQASALLRERTKDLRLAVWLTEALAIEDGIGGLTQGYTLLTSLCRQFWDHVHPLPDGDDA
EYRLGNVAWLAGRTVELLRAVPLTDGAANAFSELDWDVAQHVAQAIRRDPEQASEIARGK
PSVEQIEASKRMTPVAFYARLLGELKAFQAALDALEQELDGRAGDAAPSFRQARDAYETV
YRLAERFAKEQGYSADAQPQAVAPPAPSERAEPSFKTPLHSEEPVPRHAHAPCAPAPIVI
AGIQNRAQAVEQLRAVAKYFRGTEPHSPVAYLADKAAEWADMPLHQWLASVVKDDGSLAH
IRELLGLKPDDNA
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgccgaccaacctcaccgagctgctgacgccgatcagcgaagcgtcgccgtgcggcgac
gatctcctgttctccgccgaattcgacgcgatccagcacgcgcgcaagttcgacgatccg
tcgctcgaccagggcgaatggatcaccgatatcaaggaagcggactggggcttcgtcgtc
gagcaagcgagcgcgctgttgcgcgagcgcacgaaggatctgcggctcgcggtatggctg
accgaggcgctcgcgatcgaggacggcatcggtgggctcacgcagggctacacgctgctc
acgagcctctgccggcagttctgggaccacgtgcatccgctgcccgacggcgacgacgcc
gaataccggctcggcaacgtcgcgtggctcgccgggcgcacggtcgagctgctgcgcgcg
gtgccgctcaccgacggcgcggcgaatgcgttcagcgagctcgactgggacgtcgcgcaa
cacgtcgcgcaggcgatccggcgcgatcccgaacaggcgagcgagatcgcgcgcggcaag
ccgtccgtcgagcagatcgaggcgtcgaagcggatgacgcccgtggcgttctacgcgcgg
ctgctcggcgagctgaaagcgttccaggcggcgctcgacgcgctcgagcaggaactcgac
gggcgggcgggcgacgcggcgccgagcttccggcaggcgcgcgacgcgtacgaaaccgtc
taccggctcgccgaacgcttcgcgaaggagcagggctactcggccgacgcgcagccgcag
gccgtcgcgccgcccgcgccgagcgagcgcgcggagccgagcttcaagacgccgcttcat
tcggaggaacccgtgccgagacacgcacacgcgccgtgcgcgcccgcgccgatcgtgatc
gccggcattcagaatcgcgcgcaggccgtcgagcaactgcgcgcggtcgcgaaatatttc
cgcggaaccgagccgcacagccctgtcgcgtatctcgccgacaaggcggccgaatgggcg
gacatgccgctgcatcaatggcttgcgtcggtcgtcaaggacgacggctcgctcgcgcat
atccgcgagctgctcggcctgaagccggacgataacgcgtga

DBGET integrated database retrieval system