KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_3641
Entry
BURPS1710b_3641   CDS       T00289                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
bpm  Burkholderia pseudomallei 1710b
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpm02044]
    BURPS1710b_3641
Secretion system [BR:bpm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1710b_3641
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ABA48984
UniProt: Q3JN47
Position
I:complement(3968199..3968681)
AA seq 160 aa
MKRFEPSFLDKLFDDEPHVPAPAAMRQLSLEELKNTVARDVEAILNTRIALTEEDLAELP
ECQRSVLTYGLNDFAGLSLASHYDRTFICKSIQQAIARHEPRLQQVQVAFELNEQSTNAL
YFAIQALLVVHPAEEPVTFDAMLQPSTLQYSVTRSRAAKV
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaaacgtttcgaaccgagcttcctcgacaagctgttcgacgacgaaccgcacgtgccg
gcgcccgccgcgatgcggcagttgtcgctggaggagctgaagaacacggtcgcgcgcgac
gtcgaggcgatcctcaacacgcgcatcgcgctgaccgaagaagatctcgccgagctgccc
gaatgccagcgctcggtgctgacctacgggctgaacgatttcgccggcctgagcctcgcg
agccactacgatcgcacgttcatctgcaaatcgattcagcaggcgatcgcgcggcacgag
ccgaggctgcagcaggtgcaggtggcgttcgagctgaacgagcagtcgacgaacgcgctc
tatttcgcgatccaggcgctgctcgtcgtgcatcccgccgaggaaccggtgaccttcgat
gcgatgctgcagccgtcgacgttgcaatattcggtgacgcgttcgcgcgccgccaaggtg
tga

DBGET integrated database retrieval system