KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_3643Help
Entry
BURPS1710b_3643   CDS       T00289                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
bpm  Burkholderia pseudomallei 1710b
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpm02044]
    BURPS1710b_3643
Secretion system [BR:bpm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1710b_3643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB Sox_N
Motif
Other DBs
NCBI-ProteinID: ABA49693
UniProt: Q3JN45
Position
I:complement(3969315..3970805)
Genome map
AA seq 496 aa AA seqDB search
MNQQTAAAQSTGVQAGTESSLLDEIVEKSKVAKSESEHARAKDLIGELVSQVLDGTVVVS
DNLSATIDARVAELDRLISSQLSAVMHAAEFQRLESTWRGLDYLVKESNTGSTIKIKALH
APKRDLVRDFKNATEFDQSALFKKVYEEEFGTFGGSPFGVLVGDYEISRQPEDQYFIEQM
SHVAAAAHAPFIASAAPELLGLESFADLGKPRDLGKVFDTVEYAKWKSFRDSEDSRYVGL
TLPRFLGRLPFNPKDGAIAESFNFVEDVDGTDHDKYLWCNASWAFAARLTAAFDDFGWCA
AIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFIPLVHCKNSDY
AAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRIAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDDATQEQKAQFPLREASVQVSEIPGKPGAYRSVAFLRPHFQLDEL
SISLRLVADLPKPANS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcaaacggctgcggcccaatccaccggcgttcaagccggcacggaatcctcg
ctgctcgacgagatcgtcgagaagagcaaggtcgcgaaatccgaatccgagcatgcgcgc
gcgaaggatctgatcggcgagctcgtcagtcaggtgcttgacggcacggtggtggtgtcg
gacaacctgtcggcgaccatcgacgcgcgcgtcgcggagctcgatcgcctgatctcgtcg
cagctctcggccgtgatgcacgcggcggagttccagcgtctcgagagcacctggcgcggg
ctcgattacctggtgaaggaaagcaacaccggctcgacgatcaagatcaaggcgctgcac
gcgccgaagcgcgatctcgtgcgcgatttcaagaacgcgaccgagttcgatcagagcgcg
ctcttcaagaaggtgtacgaagaggaattcggcacgttcggcggctcgccgttcggcgtg
ctggtgggcgactacgagatctcgcgccagccggaagaccagtacttcatcgagcagatg
tcgcacgtcgcggccgccgcgcacgcgccgttcatcgcgtcggcggcgcccgagctgctc
gggctcgaatcgttcgcggatctcggcaagccgcgcgatctcggcaaggtgttcgatacc
gttgaatacgcgaagtggaagtcgttccgcgattccgaggattcgcgctacgtcggcctc
acgctgccgcgctttctcggccgcctgccgttcaatccgaaggacggcgcgatcgcggag
agcttcaacttcgtcgaggacgtcgacggcaccgatcacgacaagtacctgtggtgcaac
gcgtcgtgggcgttcgccgcgcgcctgacggcggcgttcgacgacttcggctggtgcgcg
gcgattcgcggcgtcgaaggcggcggcctcgtcgaggatctgccgacccacacgttcaag
accgacgacggcgaaatcgcgctcaagtgcccgaccgagatcgcgatcaccgaccgccgc
gagaaggaactgagcgatctcggtttcatcccgctcgtgcactgcaagaattccgattac
gccgcgttctttgccgcgcagtcggtgcagaaacccaagaaatacagcaccgacagcgcc
aacgcgaacgccgtcctgtccgctcagctgcagtacatcttctcggtatcgcgcatcgcg
cattacctgaaggcgatgatgcgcgacaagatcggcagcttcgcgtccgcgcagaacgtc
gaaacgttcctcaatcgctggatctcgcagtacgtgttgctcgacgacgacgcgacgcag
gaacagaaggcgcagttcccgctgcgcgaggcctccgtacaagtgtcagagattccgggc
aagccgggtgcgtatcgttcggtcgcgtttttgcgtccgcacttccagctcgacgagttg
tcgatttctctgcgccttgtcgctgatctgcccaaaccggcaaattcataa

DBGET integrated database retrieval system