KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_3647
Entry
BURPS1710b_3647   CDS       T00289                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS1710b_3647
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpm02044]
    BURPS1710b_3647
Secretion system [BR:bpm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1710b_3647
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ABA47849
UniProt: Q3JN41
Position
I:3972422..3973036
AA seq 204 aa
MNPHVTRYALPLAACILLGGCAAAVPLLGSAGSAALQMVGVGKPDVPDSQKPPRNLGLTL
YAAQNLNAANDNRPLALVVRLYALKDPTSFQQAPFDSFTDPTKEKTALGADLLSVREITL
IPGQHYNATEKVSREAQAFGVVALFRDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTG
GTVIPSQQGMPTQRLDLLSSVNCG
NT seq 615 nt   +upstreamnt  +downstreamnt
atgaatccgcatgtgactcgttacgcgctgccgctcgccgcctgcattctgctcggcggc
tgcgcggccgccgtgccgctcctcggttcggcgggcagcgccgcgctgcagatggtgggc
gtcggcaaacccgacgtgcccgattcgcagaagccgccgcgcaatctcggcctcacgctc
tatgcggcacagaacctcaacgccgcgaacgacaaccgtccgctcgcgctcgtcgtgcgc
ctctacgcgctgaaagatccgacgtcgttccagcaggcgccgttcgacagcttcaccgat
ccgacgaaagaaaagaccgcgctcggcgccgatctgctgagcgtgcgcgaaatcacgctg
attccggggcagcactacaacgcgaccgaaaaggtgtcgcgcgaagcgcaggcattcggc
gtcgtcgcgctctttcgcgatccggcgctacaacgctggaaactgactttcgatccggcg
aaatccgagaaatccggcataatcattggcctgcacaactgcgcgatgaccgtgacgggc
ggcaccgtcatcccttcgcagcaaggcatgccgacgcagcggctcgatttgctgtcgtcg
gtgaactgcgggtga

DBGET integrated database retrieval system