KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_3648
Entry
BURPS1710b_3648   CDS       T00289                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
bpm  Burkholderia pseudomallei 1710b
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpm02044]
    BURPS1710b_3648
Secretion system [BR:bpm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1710b_3648
SSDB
Motif
Pfam: T6SS_VasE DUF5655
Other DBs
NCBI-ProteinID: ABA48634
UniProt: Q3JN40
Position
I:3973145..3974491
AA seq 448 aa
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRFDRDALGSNVL
RASELSLVFPDGALYSAPQADELPPPIALDTLPEGINEFTFYLALHPLRETGSNYADDRD
AGFVSRFVSEQASVADHFTDAAEADITFLKTNVKLIAHSEPRDQLLSIPLVRVRRTATSG
FEIDDGFVPPCLAIEASPILHQRLRQLIDALQAKVNALYGFHREPTKNIIEFRSGDIASF
WLLHTASAAFAALAHLHQHSALHPERLFQELLRLAGQLMTFSKGYVLADLPAYRHDDPGP
GFARLDSILRELLETVISTRYFAITLEEVRPSFHVGRLDSGKIDDKTAFYLAVSADMPSV
ELVDAVPARFKVGAPDDVDKLVLSAMPGVRLAYTPQVPPAIPVRPGACYFALDARSPLYE
RMLQAQSAMIYAPSGINDLKFELIAVTS
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgagttattcggccaaggtgctctggggagaaggcctctttctgaggccgcagcacttt
cagcggcaggacgcgtatcacgaagcgcgcctgttcgaatcgatccaggcgatccagccg
tacaactggggcgtgcgttcggtgcggttcgatcgcgacgcgctcggcagcaacgtgctg
cgcgcgagcgaactgtcgctcgtgtttccggacggcgcgctctactccgcgccgcaagcc
gacgaactgccgccgcccatcgcgctcgacacgctgcccgaaggcatcaacgaattcacg
ttctacctcgcgctgcacccgctgcgcgagaccggctcgaactacgcggacgaccgcgac
gccggcttcgtgtcgcgcttcgtcagcgaacaggcgagcgttgccgatcacttcaccgac
gccgcggaagcggacatcacgttcctgaagacgaacgtgaagctgatcgcgcacagcgag
ccgcgcgaccagttgctgtcgatcccgctcgtacgcgtgcgccgcaccgcgacgtccggc
ttcgagatcgacgacggcttcgtgccgccgtgcctcgcgatcgaggcgtcgccgatcctg
catcagcgcctgcgccagttgatcgacgcgctgcaggcgaaggtgaatgcactgtacggt
ttccatcgcgagccgacgaagaacatcatcgagttccgctcgggcgacatcgcatcgttc
tggctgctgcacacggcgagcgccgcgttcgccgcgctcgcgcacctgcaccagcattcg
gccttgcatccggaacggctgttccaggaactactgcgcctcgcgggccagttgatgacg
ttctcgaagggctacgtgctcgccgatctgcccgcgtaccggcatgacgatccgggcccg
ggcttcgcgcggctcgattcgatcctgcgcgagctgctcgagaccgtgatctcgacgcgc
tacttcgcgatcacgctcgaggaagtgcggccgtcgttccatgtcgggcggctcgactcg
ggcaagatcgacgacaagaccgcgttctatctcgcggtgtcggccgacatgccgtcggtc
gaactcgtcgatgcggtgcccgcgcgcttcaaggtgggcgcgccggacgacgtcgacaag
ctcgtgctctccgcgatgccgggcgtgcgcctcgcgtacacgccgcaggtgccgcccgcg
attcccgtgcgcccgggcgcatgctatttcgcactcgatgcgcgcagcccgctctatgag
cggatgctgcaggcccagtcggcgatgatctatgcgccgtccggaatcaacgatctcaaa
ttcgaactgatcgccgtcacgtcatga

DBGET integrated database retrieval system