KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0530
Entry
BURPS1710b_A0530  CDS       T00289                                 

Definition
(GenBank) ImpA-related N-terminal family
  KO
K11910  type VI secretion system protein VasJ
Organism
bpm  Burkholderia pseudomallei 1710b
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpm02044]
    BURPS1710b_A0530
Secretion system [BR:bpm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1710b_A0530
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: ABA52359
UniProt: Q3JL64
Position
II:complement(715726..717609)
AA seq 627 aa
MSERRPPGGAAARARMPIDVEALAVLGRTDIDSAMPAGADVRADARFDALHAELAKLASP
GASGQVDWRAATHLAAELLRERGKDLLVGCYLAGALLQTGGAAGLRCGLEIVGDLVERHW
DAMSPPVSRMRARRGALQWLVDRVDAMHDAGAAACGGACSAELVAQLRAAARRIDALLAE
RDDDAPTMRAVHAFAERLPVEVVEVVEVADEADVAEATEATEATEATEAADVADVAETAE
TAETAETAEADAHGSTGGPAAEIAIAAAEQALIDPAGRAAPSAGTDTNANADAAGQPARL
DEAAGRERALADALAQLHCVATAFAQADWADARGFRLRRVACWSSVCALPETDAENGRTR
IAAPSASIVGAAKSIDGDGEPVAAVRFAEAHAQAFPLWLDLQRIAARALARAGGDGADAR
REVETAVRALLARLPGLDALTFADGTPFADDATRAWLGELGAPVVAADAVSPSSLPLSPR
PSPPERSSPMAGEPARAPGDACGASADDAVDRACAFAASGQLDLALHAIQHAIDRATSAE
QRLRARVRLCELARDHWPHEVPEAFARGVIEPIRRHDLLAWNPELALDGLSAAYALLIRR
DRESAHARTVLDEIASVDAARAMRLST
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgagcgaacggcgcccgcccggcggcgcggcggcgcgcgcgcgcatgccgatcgatgtc
gaagcgctcgccgtgctggggcgcacggacatcgattccgccatgcccgcgggcgccgac
gtgcgcgccgacgcgaggttcgacgcgctgcacgcggagcttgcgaagctcgcgtcgccg
ggcgcgagcgggcaagtcgattggcgcgcggcgacgcatctcgccgccgaattgctgcgc
gagcgcggcaaggatttgctcgtcggctgctatctggcgggtgcgttgctgcagacgggc
ggcgcggcggggctgcgctgcggactcgaaatcgtcggcgatctcgtcgaacgtcattgg
gatgcgatgtcgccgcccgtgtcgcggatgcgggcgaggcgcggggcgctgcaatggctg
gtcgatcgcgtcgacgccatgcacgatgcaggagccgccgcatgcggcggcgcgtgctcg
gccgaactggtcgcgcaattgcgcgcggccgcgcggcgcatcgatgcgctgctcgccgag
cgcgacgacgacgcgccgacgatgcgcgcggtgcatgcgttcgcggagcgattgccggtt
gaggtggttgaggtggtggaagtggctgacgaggctgatgtggctgaggcgactgaggcg
actgaggcgactgaggcgactgaggcggctgatgtggctgatgtggctgagacggctgag
acggccgagacggccgagacggccgaggccgatgcgcacggctcgacgggagggccggct
gcggaaatcgcgattgccgccgccgaacaggctttgattgatccggccggtcgagccgcg
ccgagcgcaggcacggatacgaacgcgaacgcagacgccgccgggcaaccggcgcggctc
gacgaagcggccggccgcgaacgcgcgctcgccgatgcgctcgcgcaactgcattgcgtc
gcgacggcgttcgcgcaagcggactgggccgacgcgcgcggcttccggctgcgccgcgtc
gcgtgctggtcgagcgtgtgcgcgctgccggaaacggacgcggagaacggaagaacgcgg
atcgccgcgccgagcgcttcgatcgtcggcgcggcgaagagcatcgacggggatggcgag
cccgtggcggcggtgcgcttcgccgaagcgcatgcgcaggcgttcccgctctggctggat
ttgcagcgcatcgccgcgcgcgcgctcgcgcgcgcggggggcgacggcgccgatgcgcgg
cgcgaagtggagacggcggttcgtgcgctgcttgcgcggctgccgggcctcgacgcgctg
acgttcgcggacggcacgccgttcgccgacgacgcgacgcgcgcatggctcggcgagctt
ggcgcgcctgttgtggcggcggatgcggtgtcgccgtcgtctttgccgctttcgccgcga
ccttcgccgcctgagcgatcgtcgccgatggcgggcgaaccggcgcgcgcgccgggcgat
gcgtgcggggcgagcgccgacgatgcagtggaccgagcgtgcgcgtttgccgcgagcggc
cagctcgatctcgcgctccacgcgattcagcatgcgatcgatcgtgcgacgagcgccgaa
cagcggttgagagcacgcgtgcggttgtgcgagcttgcgcgcgaccattggccgcatgag
gttcctgaggcgttcgcgcgcggcgtgatcgaaccgattcggcggcacgatttgctcgca
tggaatccggagctggcgctcgacggcttgtcggccgcctatgcgctgctgattcggcgc
gatcgcgaatcggcgcacgcgaggacggtgcttgacgagatcgcgagcgtcgacgcggcg
cgggccatgcgtttgtcgacgtga

DBGET integrated database retrieval system