KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0533
Entry
BURPS1710b_A0533  CDS       T00289                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bpm  Burkholderia pseudomallei 1710b
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpm02044]
    BURPS1710b_A0533
Secretion system [BR:bpm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1710b_A0533
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABA52260
UniProt: Q3JL60
Position
II:720429..720923
AA seq 164 aa
MTTNGSVAPKERVNIVYRPATGDAQAEVELPLKVLVLGEFSTAADKPPLEELSPVNVDKD
DFNDVMRAQNLQLALSVPNLLDDQAGEDDRLSVTLGFDSVHDFSPDAIVEKVPELKQLIA
LRDALKALKSPIGNIPGFRRRIQEIVADKGARKQLLDELGLDEQ
NT seq 495 nt   +upstreamnt  +downstreamnt
atgacaacgaacggatccgtcgcgcccaaagagcgggtcaacatcgtctatcgcccggcg
acgggcgacgcacaggcggaggtcgagctgccgctcaaggtgctcgtgctcggcgagttc
tcgacggccgccgacaagccgccgctcgaggagctctcgcccgtgaacgtcgacaaggac
gacttcaacgacgtgatgagggcgcagaacctccagctcgcgctcagcgtgccgaacctg
ctggacgatcaggccggcgaggacgaccggctgtccgtcacgctcggcttcgattcggtg
cacgatttctcgcccgacgcgatcgtcgagaaagtgcccgagctcaagcagctgatcgcg
ctgcgcgacgcgctgaaagcgctgaagagcccgatcggcaacattcccggctttcgcagg
cgcatccaggagatcgtcgccgacaagggcgcgcgcaagcagttgctcgacgaactcggc
ctcgacgaacaatga

DBGET integrated database retrieval system