KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0534
Entry
BURPS1710b_A0534  CDS       T00289                                 

Definition
(GenBank) unknown
  KO
K11900  type VI secretion system protein ImpC
Organism
bpm  Burkholderia pseudomallei 1710b
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpm02044]
    BURPS1710b_A0534
Secretion system [BR:bpm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1710b_A0534
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ABA51527
UniProt: Q3JL61
Position
II:720164..722446
AA seq 760 aa
MHRSQRSANTKPSLFRTSIDLSDAPHGSFHPQRRRHAATKNWNPAANAGSVFPSILAAPM
RLLSVSCKTPRASAHDRRPRATTKRRTQHDNERIRRAQRAGQHRLSPGDGRRTGGGRAAA
QGARARRVLDGRRQAAARGALARERRQGRLQRRDEGAEPPARAQRAEPAGRSGRRGRPAV
RHARLRFGARFLARRDRRESARAQAADRAARRAESAEEPDRQHSRLSQAHPGDRRRQGRA
QAVARRTRPRRTMNRDTEQTTMEGEHLQSPKHDDAPDATPPESPASLLDELIEAARVKRD
EDAYPITRHGIQAFVAHLAKPKRPIETVSQATIDDMIAEIDRKLCRQIDAILHDPAFQQL
ESTWRSLKFLVDRTDFRENVKVQILDVGKTALFDDFEDSPDITKSGLYQKVYTAEYGQFG
GQPIGAIVANYTFGPGAQDVKLLQYVASTSAMAHTPFIAAAGPAFFGIDSFGKLPNVKDL
ASLFEGPQYAKWNAFRESEDARYVGLTLPRFLLRLPYGANTTPVKRFNYEERVDGGDAHF
LWGNAAFAFATRLTASFADYRWCANVIGPKGGGTVTDLPLYAYESMGEIQNKIPTDVLIS
ERREFELAEQGFIALTMRKNSDNAAFFSANSTQKPKFFGISKEGKEAELNYRLSTQLPYI
FVVNRLAHYIKVIQRENIGSWKERGDLEQELNQWIRQYVVDMDNPSQSVRSRRPLRQAQI
VVSDVEGEPGWYRVDMKVRPHFKYMGAFFTLSLVGKLEKR
NT seq 2283 nt   +upstreamnt  +downstreamnt
gtgcataggtctcagaggtcggcgaatactaaaccgtctttgtttcggacatcaatcgat
cttagcgatgcgccgcacggttcttttcatccgcaacgaaggcggcacgcggcgaccaaa
aattggaacccggcggctaacgccggttccgtctttccttcgatacttgccgcgccgatg
cggcttttgagcgtttcgtgcaaaacgccgcgcgcatccgcgcacgaccgtcgcccgcga
gcgacaacgaagaggagaacccaacatgacaacgaacggatccgtcgcgcccaaagagcg
ggtcaacatcgtctatcgcccggcgacgggcgacgcacaggcggaggtcgagctgccgct
caaggtgctcgtgctcggcgagttctcgacggccgccgacaagccgccgctcgaggagct
ctcgcccgtgaacgtcgacaaggacgacttcaacgacgtgatgagggcgcagaacctcca
gctcgcgctcagcgtgccgaacctgctggacgatcaggccggcgaggacgaccggctgtc
cgtcacgctcggcttcgattcggtgcacgatttctcgcccgacgcgatcgtcgagaaagt
gcccgagctcaagcagctgatcgcgctgcgcgacgcgctgaaagcgctgaagagcccgat
cggcaacattcccggctttcgcaggcgcatccaggagatcgtcgccgacaagggcgcgcg
caagcagttgctcgacgaactcggcctcgacgaacaatgaaccgcgacacggaacagacg
accatggaaggcgaacacctgcaatccccgaagcacgacgacgcgccggacgcgacgccg
cccgagtcccccgcctcgctgctcgacgagctgatcgaggccgcgcgcgtgaagcgcgac
gaagacgcatacccgatcacgcgccacggcatccaggcgttcgtcgcgcatctggcgaag
cccaagcgcccgatcgagaccgtgagccaggcgacgatcgacgacatgatcgccgagatc
gaccgcaagctgtgccggcagatcgacgcgatcctccatgacccggcattccagcaactc
gaatcgacgtggcgctcgctgaagtttctcgtcgatcgaacggatttccgcgagaacgtg
aaggttcagattctcgacgtcggcaaaacggcgctgttcgacgacttcgaggattcgccc
gacatcacgaaatccgggctgtaccagaaggtctatacggccgagtacggccaattcggc
ggccagccgatcggcgcgatcgtcgcgaactacacgttcgggcccggcgcgcaggacgtc
aagctgctgcagtacgtcgcgagcacgtcggcgatggcgcacacgccgttcatcgcggcg
gcgggccccgcgttcttcggcatcgattcgttcggcaagctgccgaacgtgaaggatctc
gcctcgctgttcgaggggccgcaatacgcgaaatggaatgcgtttcgcgaaagcgaggac
gcgcgctacgtcggcctcacgctgccgcgcttcttgctgcggctgccttacggcgcgaac
acgacgcccgtcaagcgcttcaactacgaggagcgcgtcgacggcggcgacgcgcatttt
ctgtggggcaacgcggcgttcgcgttcgcgacgcgcctcaccgcgagcttcgccgactat
cgctggtgcgcgaacgtgatcgggccgaaaggcggcggaacggtgaccgatctgccgctc
tacgcgtacgaatcgatgggcgagatccagaacaagatcccgaccgacgtgctgatttcc
gagcgccgcgagttcgagctcgccgaacagggcttcatcgcgctgacgatgcgcaagaac
agcgacaacgccgcctttttctccgcgaactccacgcagaagccgaagttcttcggcatc
agcaaggaaggcaaggaggccgagctcaactatcggctcagcacgcaactgccgtacatc
ttcgtcgtcaaccggctcgcccattacatcaaggtgatccagcgggaaaacatcggctcg
tggaaggagcgcggcgatctcgagcaggagctcaaccagtggatccgccagtacgtcgtc
gacatggacaacccgtcgcagagcgtgcgcagccgccgcccgctgcggcaggcgcagatc
gtcgtgtcggacgtcgagggcgaacccggctggtatcgcgtggacatgaaggtgcggccg
cacttcaagtacatgggcgcgttcttcacgctgtcgctcgtcggcaagctcgaaaagcgc
tag

DBGET integrated database retrieval system