KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0535
Entry
BURPS1710b_A0535  CDS       T00289                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS1710b_A0535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpm02044]
    BURPS1710b_A0535
Secretion system [BR:bpm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1710b_A0535
SSDB
Motif
Pfam: T6SS_HCP THP2
Other DBs
NCBI-ProteinID: ABA53335
UniProt: Q3JL59
Structure
PDB: 
3WX6

Position
II:722666..723175
AA seq 169 aa
MLAGIYLKVKGKTQGEIKGSVVQEGHDGKIHILAFKNDYDMPARLQEGLTPAAAARGTIT
LTKEMDRSSPQFLQALGKREMMEEFEITIHRPKTDTTGGDLTELLFTYKFEKVLITHMDQ
YSPTPHKDDSNGIKEGLLGYIEEIKFTYSGYSLEHAESGIAGAANWTNG
NT seq 510 nt   +upstreamnt  +downstreamnt
atgctggccggaatatatctcaaggtcaaaggaaaaacccagggggaaatcaaaggctcc
gtcgttcaggaaggtcatgacgggaaaatccacatcctcgccttcaagaacgactacgac
atgcctgccaggctccaggaaggcctgacgcccgccgccgccgctcgcggcacgatcacg
ttgacgaaggaaatggacagatcgtcgccgcaattcctgcaggcgctcggcaagcgcgag
atgatggaagagttcgagatcacgatccaccgtccgaagacggatacaacaggtggggac
ctgaccgaactcctgttcacgtacaagttcgaaaaagtgctgatcacccacatggaccaa
tactcgcccacgccgcacaaagacgatagcaacggcatcaaggaaggcttgctcggctat
atcgaggagatcaagttcacgtattcgggatactcgttggaacacgcggaatcgggcatc
gcgggcgccgcaaactggacgaatggctga

DBGET integrated database retrieval system