KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0539
Entry
BURPS1710b_A0539  CDS       T00289                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
bpm  Burkholderia pseudomallei 1710b
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpm02044]
    BURPS1710b_A0539
Secretion system [BR:bpm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1710b_A0539
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ABA52721
UniProt: Q3JL55
Position
II:725396..726418
AA seq 340 aa
MPALEPVLLGEAKHFAYFQAIRLLRRIARERRGDAAGRPDAPLPIHTRPNLSLSFPDTDV
ERIDKADDGGYRVVANFFGLYGVSSPLPTFYTEDLIDEAFRGRHAARGFLDVLHRALYPL
LFDAWLKHRLALRIVEERDEHALRPLYALAGVDARIARDAGLHEHALLRYVGLLSQRPRS
AAGLRALLADAFAPATVDIEPCVPQWLPIPDDQRTRVGARAHRLGADARVGARMRDDGAR
LRIVLGDVPGPLFRALMPGGDAFARLRLLVRLYLTQPFAVDVVVRVRARDAAPARCGRRA
WSRVGLDAWLGGPSAERAASPEFRLPTSLFDQARPHHAAG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcctgctctagaacccgttctgctcggcgaggcgaagcacttcgcgtatttccaggcg
atccggctgctgcggcgcatcgcgcgcgaacggcgcggcgacgccgcggggcggcccgac
gcgccgctgccgatccacacgcggccgaatctctcgctgtcgtttccggacaccgacgtc
gagcgcatcgacaaggccgacgacggcggctaccgggtcgtcgcgaacttcttcggtctg
tacggcgtgtcctcgccgctgccgacgttctacaccgaggacctgatcgacgaagcgttc
aggggccgccacgcggcgcgcggctttctcgacgtgctgcatcgcgcgctctatccgctg
ctgttcgacgcgtggctcaagcatcggctggcgctgcggatcgtcgaggaacgcgacgag
cacgcgctgcgcccgctctacgcactcgcgggcgtcgacgcgcgcatcgcgcgcgacgcg
ggcctgcacgagcacgcgctgctgcgctacgtcgggctgctcagccagcggccgcgctcc
gcggccggtctgcgcgcgctgctcgccgacgcgttcgcgcccgcgacggtcgacatcgag
ccgtgcgtgccgcaatggctgccgattccggacgaccagcgcacccgcgtcggcgcgcgc
gcgcaccggctcggcgccgacgcgcgggtcggcgcgcgcatgcgcgacgacggcgcccgg
ctgcggatcgtgctcggcgacgtgcccggcccgctgttccgcgcgctgatgccgggcggc
gatgcgtttgcccggctgcgcttgctcgtacgcctgtatctgacccaaccgttcgccgtg
gacgtcgtggtgcgcgtgcgcgcgcgcgacgcggcccccgcgcgctgcggccgccgcgcg
tggtcgcgcgtcgggctcgacgcgtggctgggcggcccgagcgcggaacgcgcggcgtcg
cccgaattccgtcttccgacttccctctttgatcaagcgagaccccatcatgctgctggt
tga

DBGET integrated database retrieval system