KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0546
Entry
BURPS1710b_A0546  CDS       T00289                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS1710b_A0546
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpm02044]
    BURPS1710b_A0546
Secretion system [BR:bpm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1710b_A0546
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: ABA53126
UniProt: Q3JL48
Position
II:739737..740402
AA seq 221 aa
MKLTDSMMPLVAYARQLAQSPRGDAAEVALRLDILIERARDHAACAGAPAADVDDALFAV
CAWIDEALLNSGWDDADRWTLRLLQKRYFDTSHAGVVFFERLGTLDGARASVLEVYLLCL
RLGFRGRYGYDGGDGPLDAIRQRALDALSAHAPPCAAGEPPFPAAYAHAGPHAAAAKART
RRRIARAGLSVGLPLAILLSLYLIYHVVIVRMVDAVYPRLQ
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaagctgaccgattcgatgatgccgctcgtcgcgtatgcgcggcagctcgcgcaatcg
ccgcgcggcgacgccgccgaagtcgcgctgcggctcgacatcctgatcgagcgcgcgcgc
gaccacgcggcgtgcgcgggcgcacccgcggccgacgtcgacgacgcgctgttcgcggtg
tgcgcgtggatcgacgaggcgctgctgaacagcggctgggacgatgccgatcgctggacg
ctgcggctgctgcaaaagcgctacttcgatacgtcgcacgcgggcgtcgtgttcttcgaa
cgcctcggcacgctcgacggcgcgcgcgcgagcgtgctcgaggtctacctgctgtgcctg
cggctcggctttcgcggccgctacggctacgacggcggcgacggcccgctcgacgcgatc
cgccagcgcgcgctcgatgcactgtcggcgcacgcgccgccgtgcgccgcgggcgagccg
ccgtttcccgccgcctatgcgcacgccggcccgcacgccgccgccgcgaaagcgcgcacg
cgccgccggatcgcgcgcgcggggctgagcgtcgggctgccgctcgccatcctgctgtcg
ctctatctgatctatcacgtcgtcatcgtgcggatggtcgacgcggtgtaccccaggctg
caatga

DBGET integrated database retrieval system