KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0552Help
Entry
BURPS1710b_A0552  CDS       T00289                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00790  Folate biosynthesis
bpm01100  Metabolic pathways
Module
bpm_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BURPS1710b_A0552 (folE)
Enzymes [BR:bpm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BURPS1710b_A0552 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ABA52954
UniProt: Q3JL42
Position
II:746775..747458
Genome map
AA seq 227 aa AA seqDB search
MASVPEKCCGFFWRCDVMIDTQYNGACDVHHHSPAEIRRIRQFDPAAFEMAVGSLLMACG
IEIDAAHTSRTAQRVRELWQKRLLDGYDVDPAEALGVGFDDRKEDMVIIRSIAVHGVCPH
HLLPFRGVAHVAYLPGGRLHGFGRIARMIDAISHRFTYQEWITNEIATALVTHGKARGAA
CLIEAEQLCLLMGENRRGDERVITQCYVGEFDHNAQARNEFLRAINR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgttcccgaaaaatgttgtggattcttttggagatgtgatgtcatgattgac
acccaatacaatggcgcatgcgatgtccaccaccattctccggccgaaattcgacgcatc
cgccagttcgatcccgccgcattcgaaatggcggtcggtagcttgctcatggcctgtggt
atcgagatagacgccgcacataccagccgcacggcgcaacgtgtgcgggaactctggcag
aagcgcttgcttgacggctacgatgttgatcctgccgaggcgctgggtgtgggtttcgat
gatcgaaaggaagatatggtcatcatccgcagtatcgctgtccatggtgtttgtccgcat
cacttgttgccatttcgcggcgtagcacacgtggcctatctgccgggagggcgactgcat
ggcttcgggcgcatcgcccgtatgatcgatgcgatcagccatcgatttacataccaagag
tggattacaaacgagattgcgacagcccttgtcactcatggaaaagcacggggagcagct
tgcctgatcgaagccgaacaactgtgcttgctcatgggcgaaaatcgccgcggcgacgag
cgcgtaattacgcaatgctacgtgggcgaatttgaccataacgcccaggcgcgcaacgag
tttcttcgcgccatcaatcgatag

DBGET integrated database retrieval system