KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0769Help
Entry
BURPS1710b_A0769  CDS       T00289                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00260  Glycine, serine and threonine metabolism
bpm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpm01100  Metabolic pathways
bpm01110  Biosynthesis of secondary metabolites
bpm01130  Biosynthesis of antibiotics
bpm01230  Biosynthesis of amino acids
Module
bpm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BURPS1710b_A0769 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BURPS1710b_A0769 (trpB)
Enzymes [BR:bpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BURPS1710b_A0769 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABA53630
UniProt: Q3JKH5
Position
II:complement(1015766..1017031)
Genome map
AA seq 421 aa AA seqDB search
MPVRAAGAGNREPGAPRGRTESDVMYNLPDDRGHFGPYGGVFVAETLIHALDELRAAYEK
FKNDPEFVAEYNRELKHFVGRPSPIYHAQRWSETLGGAQIYLKREDLNHTGAHKVNNVIG
QALLAKRMGKRRVIAETGAGQHGVATATICARFGMECVVYMGAEDVRRQAANVYRMKLLG
ATVVPVESGSRTLKDALNEAMRDWVTNIERTFYIIGTVAGPHPYPMMVRDFQRVIGDECK
VQMPELAGRQPDAVIACVGGGSNAMGIFYPYIDDAAVQLIGVEAAGDGLDTGHHAASLIA
GSPGVLHGNRTYLLQDDDGQIIETHSVSAGLDYPGVGPEHAWLKDSGRAQYVGITDEEAL
KAFHDCCRIEGIIPALESSHAIAYGVKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGIT
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgccagtccgcgcggcgggcgccgggaatcgagagcccggcgcgccgcgtggtcgaacc
gagagtgacgtcatgtataaccttcccgatgatcgcggccatttcggcccatatggcggc
gtgtttgtcgccgaaacgctgattcacgcgctcgacgagctgcgtgccgcgtacgagaaa
ttcaagaacgaccccgagttcgtcgccgaatacaaccgtgagctgaagcacttcgtcggc
cgtccgtcgccgatctatcacgcgcagcgctggagcgagacgctcggcggcgcgcagatc
tacctgaagcgcgaggacctgaaccacacgggcgcgcacaaggtgaacaacgtgatcggc
caggcgctgctcgccaagcgcatgggcaagcggcgcgtgatcgccgagacgggcgcgggc
cagcacggcgtcgccaccgcgacgatctgcgcgcgcttcggcatggagtgcgtcgtctac
atgggcgccgaggacgtgcgtcggcaggccgcgaacgtctaccggatgaagctgctcggc
gcgaccgtcgtgcccgtcgaatccggctcgcgcacgctgaaggatgcgttgaacgaggcg
atgcgcgactgggtcacgaacatcgagcgcacgttctacatcatcggcacggtggcgggc
ccgcatccgtatccgatgatggtgcgcgacttccagcgcgtgatcggcgacgaatgcaag
gtgcagatgcccgagctcgccggccggcagcccgacgcggtgatcgcctgcgtcggcggc
ggctcgaacgcgatgggcatcttctacccgtacatcgacgacgcggccgtccaattgatc
ggcgtcgaggcggcgggcgacgggctcgacaccggccatcacgcggcgtcgctgatcgcc
ggcagcccgggcgtgctgcacggcaaccgcacgtatctgctgcaggacgacgacggccag
atcatcgagacgcattcggtatcggccggcctcgactatccgggcgtcggccccgagcat
gcctggctgaaggacagcggccgcgcgcagtacgtcgggatcaccgacgaagaggcgctg
aaggcgtttcacgactgctgccggatcgaggggatcattcccgcgctcgaatcgagccac
gcgatcgcctacggcgtgaagctcgcgccgacgctgccgaaggacaagatcctcctcgtc
aacctgtcggggcgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatcacg
ctctga

DBGET integrated database retrieval system