KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1140
Entry
BURPS1710b_A1140  CDS       T00289                                 

Definition
(GenBank) lectin
Organism
bpm  Burkholderia pseudomallei 1710b
SSDB
Motif
Pfam: B_lectin
Other DBs
NCBI-ProteinID: ABA52621
UniProt: Q3JJF6
Position
II:1422034..1422732
AA seq 232 aa
MSQMYGTQPEGALYVGKGDRLVMQTDGRLVFYSGNDVVWSNWYYGPAPIPGSYAVVEDFG
VVAIYPPQGGYPTFTWPFASVTPNSGALATVVGYPFGVNFPVLNGRQWLQIFNNVTYYLW
NKSFAADSVAMQTDGNLVVYNKGQPVWSTGTSGNPGTYMLVTPVGFVLGKQYGGILANVP
YPVSVDQSSRASGPNDPKPTPAAPPSPSLNLPINASWKCYYVKDWLACYAPG
NT seq 699 nt   +upstreamnt  +downstreamnt
atgtcgcaaatgtacggaacgcagcccgagggcgcgctctacgtcggcaagggcgaccgg
ctcgtgatgcagaccgacgggcggctcgtgttctattcgggcaacgacgtcgtctggagc
aactggtattacggccccgcgccgatccccggctcgtatgcggtcgtcgaggatttcggc
gtcgtcgcgatctatccgccgcagggcggctatccgacgttcacctggccgttcgcgtcg
gtcacgccgaacagcggcgcgctcgcgacggtggtcggctatccgttcggcgtgaacttc
ccggtgctcaacgggcgtcaatggctgcagatcttcaacaacgtcacttactacctgtgg
aacaagagcttcgccgcggacagcgtcgcgatgcagaccgacggcaatctcgtcgtctac
aacaaggggcagccggtctggtcgacgggaacgtcgggcaatccgggcacctacatgctg
gtgacgcctgtcggcttcgtgctcggcaagcagtacggcggcatcctcgcgaacgtgccc
tacccggtgtccgtcgatcagtcgagccgcgcgagcggcccgaacgatccgaagccgacg
ccggccgcgccgccgtcgccctcgctgaacctgccgatcaatgcgagctggaagtgctat
tacgtgaaggactggctcgcgtgctacgcgccgggttga

DBGET integrated database retrieval system