KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1541Help
Entry
BURPS1710b_A1541  CDS       T00289                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP) family protein
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00040  Pentose and glucuronate interconversions
bpm00053  Ascorbate and aldarate metabolism
bpm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BURPS1710b_A1541
   00053 Ascorbate and aldarate metabolism
    BURPS1710b_A1541
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     BURPS1710b_A1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABA52732
UniProt: Q3JIA5
Position
II:1871734..1873713
Genome map
AA seq 659 aa AA seqDB search
MWLFGFKSIVARARAEADIPSWALNRRLAFATIAIPAGNAACSHSFAGRRACAQDMATGA
GTRAPVGMRGARVAVCHDNGMHARRGGAIRRTGRSPRLVQFDPFDPFDPFVRRRRTPHRE
AHRPRPGFQFGGSMQITGEMLIGAAAVRGSEGTMRAYAPAQGVELEPTFGAGGAADVDRA
CRLANAAFDPFRQAPLETRARFLEAIAERIVGLGDPLIERAHAESALPVARLEGERARTV
GQLRLFAAIVRDGRWLSATLDSAQPERKPLPRADLRLQKIPVGPVAVFGASNFPLAFSVA
GGDTASAFAAGCPVVAKAHPAHLGTSELVGRAIRQAVADCGLHEGVFSLVVGAGNAIGEA
LVAHPAIRAVGFTGSRAGGLALMGVAARRHEPIPVFAEMSSINPFFVLPGALRARGAQIA
QGFVESLTLGVGQFCTNPGLVVALEGPDLKAFVDAAAQALSQKGAQTMLTSGIASSYESA
VAARRAAAGVSEVARGVRSDARNAALPALFTTTHTQFVQNPQLEAEIFGPTSLVVACRDI
DEMIALAEHVEGQLSATLHLEDDDVDLARKLLPTLERRAGRIVANGYPTGVEVAYAMVHG
GPFPATSDPRSTSVGALAIERFLRPVCYQDLPAALLPEALADANPLGLWRLRDGQLGKA
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
gtgtggctgttcggcttcaagtcgatcgttgcgcgagcccgcgccgaagccgatatcccg
tcatgggccctcaaccggcggctcgcgttcgcgacgattgcaatcccggccgggaatgcc
gcgtgttcgcattcgtttgccggacggcgcgcatgcgcgcaggacatggcgaccggtgcg
ggcacgcgtgcgccggtcgggatgcgcggcgcacgcgttgccgtctgccacgataatgga
atgcatgcgcgccggggcggtgcgatccgtcgaaccggccggtcgcctcgactcgttcaa
ttcgacccattcgacccattcgacccattcgtccgcaggcggcgcacgccgcatcgcgaa
gcgcaccgcccgcggccaggtttccaattcggaggaagcatgcagatcaccggcgagatg
ttgattggcgcggccgcggtgcgcggtagcgaaggcacgatgcgcgcttacgcgccggcg
cagggcgtcgagctcgagccgacgttcggcgcgggcggtgcggccgacgtcgatcgcgcg
tgccgcctcgcgaacgccgctttcgatccctttcgtcaggcgccgctcgagacgcgcgca
cgctttctcgaggcgatcgccgagcgcatcgtcgggctcggcgatccattgatcgaacgc
gcgcacgcggaatcggcgctgcccgtcgcgcggctcgaaggcgagcgcgcgcgcacggtc
ggtcagctcaggctcttcgcggcgatcgtgcgcgacggccgctggctgagcgcgacgctc
gattccgcgcagcccgagcgcaagccgctgccgcgcgccgatctgcgcttgcagaagatt
cccgtcggcccggtcgcggtgttcggcgcgagcaatttcccgctcgcgttctcggtcgcg
ggcggcgacaccgcttcggcgttcgcggccggctgccccgtcgtcgcgaaggcgcacccc
gcgcatctcggcacgtcggagctcgtcgggcgcgcgatccggcaggctgtcgccgattgc
ggtttgcacgagggcgtgttctcgctcgtcgtcggcgcgggcaacgcgatcggcgaggcg
ctcgtcgcgcatcccgcgatcagggcggtcggcttcaccggctcgcgcgcgggcggcctt
gcgctgatgggcgttgccgcgcggcggcacgagccgattccggtcttcgcggaaatgagc
agcatcaatccgttcttcgtgttgcccggcgcgttgcgcgcacgcggtgcgcaaatcgcg
caaggcttcgtcgaatcgctgacgctcggcgtcgggcagttctgcacgaacccggggctc
gtcgtcgcgctcgaagggcccgacctgaaggcgttcgtcgacgcggccgcgcaggcgctc
tcgcaaaagggcgcgcagacgatgctgacctcgggcatcgcgtcgtcttacgagagcgcg
gtcgcggcgcgccgcgcggccgcgggcgtcagcgaggtcgcgcgcggcgtgcgcagcgac
gcgcggaacgccgcgttgcccgcgctcttcacgacgacgcacacgcagttcgtccagaac
ccgcagctcgaagccgagatcttcgggccgacgtcgctcgtcgtcgcgtgccgcgacatc
gacgagatgatcgcgcttgccgagcatgtcgaggggcaactgagcgcgacgctgcatctc
gaagacgacgatgtcgatctggcgcgcaaactgctgccgacgctcgagcgccgcgccggc
cgcatcgtcgcgaacggctatccgacgggcgtcgaggtcgcgtacgcgatggtgcacggc
gggccgtttccggcgacgtcggacccgcgcagcacatcggtgggcgcgcttgcgatcgag
cgcttcctgcggcccgtctgctatcaggatttgccggcggcgttgttgcccgaggcgctc
gccgacgcgaatccgctcggcctctggcgcctgcgcgacggccaactcggcaaggcgtga

DBGET integrated database retrieval system