KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1582
Entry
BURPS1710b_A1582  CDS       T00289                                 

Definition
(GenBank) Rhs element Vgr protein subfamily, putative
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS1710b_A1582
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpm02044]
    BURPS1710b_A1582
Secretion system [BR:bpm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1710b_A1582
SSDB
Motif
Pfam: Phage_GPD T6SS_Vgr DUF2345 Phage_base_V
Other DBs
NCBI-ProteinID: ABA52989
UniProt: Q3JI64
Position
II:1927567..1930143
AA seq 858 aa
MTNLNDTLRNFASGAVDWNKRPVALHFGAAQAALGHLLALQHASVQEGLMTGIHGRLTCV
STRRDLPPGVLLGIPVSIRLITDRGQPHTVNAIISGVQIGQSDGELCVYQLTVCDALSLM
DKRTNSRVFRKRSVIDVLATLFNEWQQRSPALARAFEFDLSGLRADRYPPRELTRQVNES
DAHFVRRLLRREGITVFAKAGPAKGERPLQGDAPVHTLVCCDDPMSLPQAPAGTVRLHPR
DGGAAQRDTVTLFALRRQLAPGKAGRPSWDYKKARIDESSVASGLDQGEAGNDLAKLLTD
IAIDIAHAGDSWRDHERLTRARMLAHEFEAERHDGVSSVRDLAVGTWITLTGDPQWDRQR
ADKRQFVITSIDHDIWNNLPKGLNERVHALFAASRNLACAPRALPSALANDADTRYENTF
ACVRRGVPLAPAYDPQADLPPAHLLTGTIVGAEGEEVFCDEDGRVRVRVHGLDPADHAHA
QGAGTNGNAGDSAPIRVASSLAGAHFGASFLPRVGMEVLLGCLGGDPDRLVIIGVLGNGA
HPPATFSHAGGLPGNRYLSGIKTKEIRGQRYNQLRLDDTPNQISAQLASEHAHSQLNLGY
LTQPRENGHGNDRGEGVELRTDAAAALRAAQGMLLTTYARTQASGGQLDRDELIRLLGEC
AELFKALGDYAGQHGGQAADTAGQHAVAAAFKRWAPGTGTDGAARALMAFGAQAGSVNVT
PKTHVTYAGENIDQVAQQHLQLMSGQRLNATAGQGMQLFARGAGVQAVAGEGPMLLQAQA
GTLTANAQKGVKITTNTSGAGRRPRRRRRAGSAISRRISVSSCTIRARTAICRRRRTSGS
GSRWTTGASSKARPTRAA
NT seq 2577 nt   +upstreamnt  +downstreamnt
gtgaccaatttgaacgatacgctacgcaattttgcgtcgggggcggtcgactggaataaa
cgtccggtcgcgttgcactttggcgccgcgcaggccgcgctgggccacctcctcgcgctg
cagcacgccagtgttcaggaaggcctgatgaccgggatccacggccgattgacctgcgtg
tcgacccgccgcgaccttccgcccggcgtgttgctcggcattccggtttcgatccggctc
attaccgaccgcggacagccgcacacggtgaacgcgatcatcagcggcgtccagatcggc
caaagcgacggcgagctctgtgtgtaccagctgacggtctgcgacgcgctgtcgctgatg
gacaagcgcaccaattcgcgggtcttccgaaagcgcagcgtcatcgatgtgctcgccacg
ctgttcaacgaatggcagcagcgcagcccggccctcgcgcgcgcgttcgaattcgatctg
tccggcttgcgcgccgatcgctatccgccccgcgagctgacccggcaggtcaacgaatcg
gatgcgcatttcgtgcgccgtctgctgcgccgcgaagggatcaccgtgttcgcgaaggcg
gggccggcgaagggcgaacggccgttgcagggcgacgcgcccgtgcacacgctcgtgtgc
tgtgacgatccgatgtcgttgccgcaagcgccggccggcacggtccgcctgcatccgcgc
gacggcggcgccgcgcagcgcgacacggtcacgctgttcgcgctgcgtcggcaattggcg
cccggcaaggccgggcgcccgtcgtgggactacaagaaggcgcggatcgacgaatcgagc
gtcgcttcgggcctcgatcagggcgaggcgggcaacgatctggcgaagctgctgaccgac
atcgcgatcgacattgcgcacgcgggcgattcatggcgcgatcacgagcggctcacccgc
gcgcgcatgctcgcgcacgagttcgaagccgagcgccatgacggcgtcagcagcgtgcgg
gatctcgccgtgggcacatggatcacgctgacgggcgatccgcaatgggacaggcaacgc
gccgacaagcgtcagttcgtgatcacgtcgatcgatcacgacatctggaacaacctgccg
aaggggctcaacgagcgcgtgcacgcgctgttcgccgcgagccgcaatctcgcgtgcgcg
ccccgcgcgctgccgtccgcgctggcgaacgacgcggatacccgctacgagaacacgttc
gcgtgcgtgcgccgcggcgtgccgcttgcgcccgcgtacgatccgcaagccgatttgccg
cccgcgcatctgctcacgggcacgattgtcggcgcggagggcgaagaagtgttctgcgac
gaagacggccgggtgcgcgtgcgggtgcacggcctcgatccggcggatcacgcgcacgcg
cagggcgcgggcaccaacggcaacgcgggcgacagcgcgccgatccgcgtggcgtcgagc
ctcgccggcgcccatttcggcgcatcgtttctgccgcgagtcggcatggaagtccttctc
gggtgtctcggcggcgatccggaccggctggtgatcatcggcgtgctcggtaacggcgcg
catccgccggcgacgttcagccacgcgggcgggctgccgggcaaccgctacctgtcgggc
atcaagacgaaggagattcgtgggcaacggtacaaccagctgcgtctcgacgacacgccg
aaccagatcagcgcgcaactggcgagcgagcacgcgcattcgcagctcaatctcggatat
ctgacgcaaccgcgcgagaacggccacgggaacgaccgcggcgagggcgtggagttgcgt
accgacgcggcggcggcgctgcgggcggcgcaaggcatgctgctgacgacctacgcgcgc
acgcaggcgagcggcgggcaactggaccgtgacgagctgattcggttgctcggcgaatgc
gcggagctgttcaaggcgctgggcgactacgcggggcagcacggcgggcaggccgcggat
acggccggccagcacgcggtggccgccgcgttcaagcgctgggcgccgggcacgggcacg
gacggcgcagcgcgcgcgctgatggcgttcggcgcgcaggccggttcggtgaacgtcacg
ccgaagacgcatgtgacgtatgccggcgagaacatcgatcaggtcgcgcagcagcacctg
caactgatgagcggccagcggctgaacgcgacggccgggcagggcatgcagctcttcgcg
cggggcgcgggggtgcaggccgtggcgggcgaagggccgatgctgctgcaggcgcaagcc
ggcacgctgacggcgaacgcgcagaagggcgtcaagatcacgacgaacaccagtggggcg
ggccgtcgaccgcgcaggcggcgaagagcgggttcggcaatcagccgacggatcagcgtt
tcaagctgcactatccgggcgaggacggcgatttgcaggcggcggcgaacaagcggttcc
ggatcacgctggacgacgggcgcgtcatcgaaggcaagaccgacgcgagcggcctga

DBGET integrated database retrieval system