KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1793
Entry
BURPS1710b_A1793  CDS       T00289                                 

Definition
(GenBank) sugar-binding transcriptional regulator, LacI family
  KO
K17205  putative xylitol transport system substrate-binding protein
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BURPS1710b_A1793
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpm02000]
    BURPS1710b_A1793
Transporters [BR:bpm02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative xylitol transporter
    BURPS1710b_A1793
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_3 Peripla_BP_1 DUF3986
Other DBs
NCBI-ProteinID: ABA53508
UniProt: Q3JHK3
Position
II:2183389..2184417
AA seq 342 aa
MQTRKTWFGRFAAAAALGATLAIAAAGSAAHAASGPYRIGAAVYGMKGQFMQNWVREIKA
HPAVKSGAVQLTVFDGNYDALTQNNQIETMLTQQYSGILFVPIDTKAGIGVAARAGASDT
PLVASNTMLATPKVPYIGNDDVEGGRLQAEALARRIGGKGNVVIIQGPIGQSAQIDREKG
EMEVLAKYPGIKVIEKKTANWSRAEAMNLMEDWLNAHPKQINGVIAQNDDMALGALQAIK
NRGLTPKDIPITSIDGMPDAIQAAKRGEITTFLQDAQAQSQGALDLVLRQLVGAGYKPQS
VIWQRYAKDLKWDGGTAKRYILPWVPVTPANADQLYKQVTGG
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgcaaacacgaaagacctggttcggccgcttcgcggccgcggcggcgctcggcgcgacg
ctcgcgatcgcggcggcggggagcgcggcgcacgcggcgagcgggccgtatcgcatcggc
gcggcggtctacggaatgaaaggccagttcatgcagaactgggtgcgcgagatcaaggcg
catccggccgtgaagagcggcgccgtgcagctcacggtgttcgacggcaactacgacgcg
ctcacgcagaacaaccagatcgagacgatgctcacgcagcagtacagcggcattttgttc
gtgccgatcgacacgaaggcggggatcggcgttgcggcgcgcgcgggcgcctccgacacg
ccgctcgtcgcgtcgaacacgatgctcgcgacgccgaaggtgccgtacatcggcaacgac
gacgtcgagggcggccgcctgcaggccgaggcgctcgccaggcggatcggcggcaagggc
aatgtcgtgatcatccaggggccgatcggccagtccgcgcagatcgatcgcgagaagggc
gagatggaggtgctcgcgaaatatccgggcatcaaggtgatcgagaagaagaccgcgaac
tggtcgcgcgcggaagcgatgaacctgatggaagactggctgaacgcgcatccgaagcag
atcaacggcgtgatcgcgcagaacgacgacatggcgctcggcgcgttgcaggcgatcaag
aaccgcgggctcacgccgaaggacatcccgatcacgtcgatcgacgggatgcccgacgcg
atccaggccgccaagcgcggcgagatcacgacgttcctgcaggacgcgcaggcgcaatcg
caaggcgcgctcgacctcgtgctgcggcagctcgtcggcgcgggctacaagccgcaatcg
gtgatctggcagcgctacgcgaaggatctgaagtgggacggcggcaccgcgaagcgctac
atcctgccgtgggtgcccgtcacgccggcgaacgccgatcagttgtacaagcaggtcacg
ggcggttga

DBGET integrated database retrieval system