KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1939Help
Entry
BURPS1710b_A1939  CDS       T00289                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00010  Glycolysis / Gluconeogenesis
bpm00620  Pyruvate metabolism
bpm00640  Propanoate metabolism
bpm00680  Methane metabolism
bpm01100  Metabolic pathways
bpm01110  Biosynthesis of secondary metabolites
bpm01120  Microbial metabolism in diverse environments
bpm01130  Biosynthesis of antibiotics
bpm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1710b_A1939 (acsA)
   00620 Pyruvate metabolism
    BURPS1710b_A1939 (acsA)
   00640 Propanoate metabolism
    BURPS1710b_A1939 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BURPS1710b_A1939 (acsA)
Enzymes [BR:bpm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BURPS1710b_A1939 (acsA)
Lipid biosynthesis proteins [BR:bpm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BURPS1710b_A1939 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABA51683
UniProt: Q3JH62
Position
II:2352954..2354936
Genome map
AA seq 660 aa AA seqDB search
MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAERDYEGFWARLARETLEWRKP
FGKVLDETNAPFYKWFEDGELNASYNCLDRHVAAGLGERVAVIFEADDGTVTRVTYADLL
ARVSRFANALKKRGVGRGDRVVIYIPMSVEGIVAMQACARIGATHSVVFGGFSSKSLHER
IVDVGATALVTADEQMRGGKTLPLKSIADEALAMGGCDAVKTVVVYRRTGGNVDWHAGRD
VWMHEMVANESDACEPEWVGAEHPLFILYTSGSTGKPKGVQHSTAGYLLWVAQTMKWTFD
WKPDDVFWCTADIGWVTGHSYITYGPLAVGATQVVFEGVPTYPNAGRFWKMIGDHKVTVF
YTAPTAIRSLIKAAEADDRVHPRSYDLSSLRIIGTVGEPINPEAWIWYHKNVGQARCPIV
DTWWQTETGGHMITPLPGATPTVPGSCTLPLPGIMAAVVDETGQDVPNGQGGILVVKRPW
PAMARTIWGDPERFKKSYFPEELGGRLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRL
GTMEIESALVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEGEEAAALAKTLRDWVG
KEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAILEQLAEVR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgattgaatcggttctgcacgaacgccgccagttcgcgccgcccgccgccgtg
gagaaggcggcagccatttccgggatggcggcttatcgggcgctcgccgaagaggctgag
cgcgattacgaaggattctgggcgcgtctcgcgcgcgagacgctcgaatggcgcaagccg
ttcggcaaggtgctcgacgagacgaacgcgccgttctacaagtggttcgaggacggcgag
ctgaacgcgtcgtacaactgcctcgaccgccacgtcgccgcgggcttgggcgagcgcgtc
gcggtgatcttcgaggccgacgacggcaccgtcacgcgcgtcacctacgccgatctgctc
gcgcgcgtgtcgcgcttcgcgaacgcgctgaagaagcgcggcgtcggccgcggcgaccgc
gtcgtcatctacattccgatgtcggtcgaaggcatcgtcgcgatgcaggcatgcgcgcgg
atcggcgcgacgcactcggtggtgttcggcggcttctcgtcgaagtcgctgcacgagcgc
atcgtcgacgtcggcgcgaccgcgctcgtcaccgccgacgagcagatgcgcggcggcaag
acgctgccgctcaagagcatcgccgacgaggcgctcgcgatgggcggctgcgacgcggtg
aagaccgtcgtcgtgtatcgccgcacgggcggcaatgtcgactggcacgcgggccgcgac
gtctggatgcacgagatggtcgcgaacgagtccgacgcgtgcgagcccgaatgggtcggc
gccgagcatccgctgttcatcctgtacacgtccggctcgaccggcaagccgaagggcgtc
cagcacagcacggccggctatctgctgtgggtcgcgcagacgatgaagtggacgttcgac
tggaagcccgacgacgtgttctggtgcacggccgacatcggctgggtcacgggccactcg
tatatcacgtatgggccgctcgccgtcggcgcgacgcaggtggtgttcgagggcgtgccg
acctatccgaacgcgggccgcttctggaagatgatcggcgaccacaaggtcaccgtgttc
tacaccgcgccgaccgcgatccgctcgctgatcaaggcggccgaggccgacgaccgcgtg
catccgaggagctacgatctgtcgagcctgcggatcatcggcacggtcggcgagccgatc
aatccggaagcgtggatctggtatcacaagaacgtcgggcaggcgcgctgcccgatcgtc
gacacctggtggcagaccgaaacgggcggccacatgatcacgccgctaccgggcgcgacg
ccgacggtgccgggctcgtgcacgctgccgctgccgggcatcatggccgcggtcgtcgac
gagacgggccaggacgtgccgaacgggcagggcggcattctcgtcgtcaagcgcccgtgg
ccggcgatggcgcgcacgatctggggcgacccggagcgcttcaagaagagctatttcccc
gaggagctcggcggccgcctgtatctggcgggcgacggcaccgtgcgggacaaggaaacc
ggctacttcacgatcatgggccgcatcgacgacgtgctgaacgtatcggggcaccggctc
ggcacgatggagatcgaatcggcgctcgtgtcgcacgagctcgtcgccgaggcggccgtc
gtcggacggccggacgacacgacgggcgaggcggtcgtcgcgttcgtcgtgctcaagcgc
tcgcggccggaaggcgaggaggcggccgcgctcgcgaagacgctgcgcgactgggtcggc
aaggagatcgggccgatcgcgaagccgaaggacatccgtttcggcgataacctgccgaag
acgcgttcgggcaagatcatgcggcgcctgttgcgctcgctcgcgaagggcgaggcgatc
acgcaggatacgtcgacgctcgagaaccccgcgatcctcgaacagctcgccgaagtgcgc
tga

DBGET integrated database retrieval system