KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A2071Help
Entry
BURPS1710b_A2071  CDS       T00289                                 

Gene name
aarC
Definition
(GenBank) acetyl-CoA hydrolase/transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00020  Citrate cycle (TCA cycle)
bpm00620  Pyruvate metabolism
bpm00650  Butanoate metabolism
bpm01100  Metabolic pathways
bpm01110  Biosynthesis of secondary metabolites
bpm01120  Microbial metabolism in diverse environments
bpm01130  Biosynthesis of antibiotics
bpm01200  Carbon metabolism
Module
bpm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BURPS1710b_A2071 (aarC)
   00620 Pyruvate metabolism
    BURPS1710b_A2071 (aarC)
   00650 Butanoate metabolism
    BURPS1710b_A2071 (aarC)
Enzymes [BR:bpm01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     BURPS1710b_A2071 (aarC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: ABA52179
UniProt: Q3JGT1
Position
II:2518722..2520350
Genome map
AA seq 542 aa AA seqDB search
MLPPPLLRLPQAPGARATPETPLRRSVARSTTTVRHSAMPTSRILAPSLRSLVRTADEAA
ALIGPNMTVAMSGFTGSGYPKAVPAALAARIAASHARGEDFRINVLTGASTAPELDGALA
KADGISMRLPYQSDPTLREKINAGELDYQDIHLSHVAQYAWFGLFGELDVAIVEVAGIRE
DGRLIPSASVGNNKTWLDQAKRVILEVNARQPLGLDGMHDIYYGTALPPNRKPIPLVKSD
DRIGEPYLRCPAEKIVAIVETDAPDRSNAFAAPDETSKQIAGLLIDFLRHEIKRGRLPEH
LLPLQSGVGNITNAVLAGLGEGGFSNLSAYTEVIQDGMLDLLANGTLSFASATALSLSPD
AVKRFADEIDTFRSKIVLRPQEISNHPELVRRLGIIAMNGMIEADIYGNVNSTHVMGTRI
QNGIGGSGDFARNGYLSCFMSASTAKGGAISRIVPMASHVDHTEHDVAVVVTEQGLADLR
GLSPKQRARKVIANCAHPDYRPMLEDYFERASRESFGKQTPHLLGEALSWHERYVRTGSM
KA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
gtgcttccgccgcccctcttgcgattgccgcaggcgccgggagcgcgcgccactccggag
acacccctgcggcgcagcgtcgccagatctactacaaccgttcgacattcagccatgcca
acctctcgtatcctcgcccccagcctgcgctccctcgttcgcaccgccgacgaggccgcc
gcgctgatcggcccgaacatgaccgtcgcgatgagcggcttcaccggctccggctatccg
aaggcggtgccggccgcgctcgccgcgcggatcgcggcttcccacgcgcgcggcgaagat
ttccgcatcaacgtgctgacgggcgcgtcgaccgcgcccgagctggacggcgcgctcgcg
aaggcggacggtatctcgatgcggctgccgtaccagtccgatccgacgctgcgcgagaag
atcaacgcgggcgagctcgactatcaggacatccacctgagccacgtcgcgcagtacgcg
tggttcggcctgttcggcgagctggacgtcgcgatcgtcgaggtcgcgggcattcgcgag
gacgggcgcctgattccgtcggcgtcggtcggcaacaacaagacgtggctcgaccaggcc
aagcgcgtgatcctcgaggtgaacgcgcgccagccgctcggtctcgacgggatgcacgac
atctattacggcaccgcgctgccgccgaaccgcaagccgattccgctcgtgaagagcgac
gaccggatcggcgagccgtatctgcgctgcccggccgagaagatcgtcgcgatcgtcgag
accgacgcgccggaccgcagcaacgcgttcgccgcgccggacgagacctccaagcagatc
gccggactcctgatcgatttcctgcgtcacgagatcaagcgcggccgtctgcccgaacac
ctgctgccgctgcagtccggcgtcggcaacatcacgaacgcggtgctcgccggcctcggc
gaaggcggtttctcgaacctgagcgcgtatacggaagtgattcaggacggcatgctcgat
ctgctcgcgaacggtacgctgagcttcgcgtcggcgaccgcgctgtcgctcagcccggat
gcggtgaagcgcttcgccgacgagatcgatacgttccgctcgaagatcgtgctgcggccg
caggaaatcagcaaccatccggagctcgtgcggcgcctgggcatcatcgcgatgaacggg
atgatcgaggccgatatctacggcaacgtgaactcgacgcacgtgatgggcacgaggatt
cagaacgggatcggcggctccggcgatttcgcgcgcaacggctatctgtcgtgcttcatg
tcggcgagtaccgccaagggcggcgcgatttcgcggatcgtgccgatggcgagccacgtt
gaccataccgagcacgacgtcgcggtcgtcgtgaccgagcaggggctcgcggatctgcgt
ggactgtcgccgaagcagcgcgcgcgcaaggtcatcgcgaactgcgcgcatcccgattac
cggccgatgctcgaagactacttcgagcgcgcgagccgcgagagcttcggcaagcagacg
ccgcatctgctcggcgaagcgctgtcgtggcacgagcgctacgtgcggaccggatcgatg
aaagcctga

DBGET integrated database retrieval system