KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A2076
Entry
BURPS1710b_A2076  CDS       T00289                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS1710b_A2076
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpm02044]
    BURPS1710b_A2076
Secretion system [BR:bpm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1710b_A2076
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABA51215
UniProt: Q3JGS6
Position
II:2525243..2525770
AA seq 175 aa
MANALVDYFLQIDGVEGESTDQQYPGLIQIQSWQWAEENSGRWGFGSGGGAGKVEMKDFE
FRMVSNKASPKLFLMCATGEHIQNAKLICRKSGKGQQEFLTISFASGLVSSFRTLGNMPI
SQLGHASGEVDGVLPTDQIRINFAQIEFEYREQRNDGTMGAVIKAGYDLKQNAPI
NT seq 528 nt   +upstreamnt  +downstreamnt
atggcaaatgctttggttgattacttcttgcagatcgatggcgtcgagggtgagtcgacc
gatcagcaatatcccggtctgatccagatccagagctggcagtgggcggaagagaactcg
ggccgctggggcttcggcagcggcggcggcgcgggcaaggtcgagatgaaggacttcgag
ttccgcatggtgtcgaacaaggcgtcgccgaagctgttcctgatgtgcgcgacgggtgag
cacatccagaacgcgaagctgatctgccgcaagtcgggcaagggccagcaggagttcctg
acgatctcgttcgcgagcggcctcgtgtcgtcgttccgcacgctcggcaacatgccgatc
tcgcagctcggtcacgcgagcggcgaagtcgacggcgtgctgccgacggatcagatccgc
atcaacttcgcccagatcgagttcgagtaccgcgagcagcgcaacgacggcacgatgggc
gccgtgatcaaggcgggctacgacctgaagcagaacgcgccgatctaa

DBGET integrated database retrieval system