KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_117Help
Entry
BPEN_117          CDS       T00272                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
bpn00260  Glycine, serine and threonine metabolism
bpn00750  Vitamin B6 metabolism
bpn01100  Metabolic pathways
bpn01110  Biosynthesis of secondary metabolites
bpn01120  Microbial metabolism in diverse environments
bpn01230  Biosynthesis of amino acids
Module
bpn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPEN_117 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BPEN_117 (thrC)
Enzymes [BR:bpn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BPEN_117 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AAZ40757
UniProt: Q493S8
Position
139712..141013
Genome map
AA seq 433 aa AA seqDB search
MKLYNIKQPSEQVTFTQALLQGLGKNQGLFFPKDLPKFSIFEINSLLEMSFIERSTHILS
TYIGSELSKNSILTCVKNAFNFPVPLVCINNNVAILELFHGPTLAFKDFGSRLMAQMLNQ
TNHCSDKPMVILTATSGDTGAAVAHAFFNLSNIHVIILYPRGKISALQEKLFCTLGGNIS
TISVNGDFDSCQRLVKKAFDDSVLRQKLNLNSANSINIGRLLAQICYYFEGVSQLPHQMR
NKLVIAVPSGNFGNLTAGLLAQSCGLPVKKFIAATNINDTVPRFLEFGYWEPRPTLSTFS
NAMDVSSPNNWSRIEELFRRENKSIKELEYGCVNDFLTEKTVQEIADLGYLSEPHTAVAY
RLLCDKLHSDEFGICLGTAHPVKFKELVEDFLKKKIQLILPIVLKERMKLPVLSFKIPKC
FSSLRNLILSIMS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatataatattaagcaacctagtgaacaagtcacgtttactcaagctctctta
caaggattaggaaaaaatcaggggttatttttcccaaaagatcttccaaaattctctata
tttgaaataaattctctcttagaaatgagttttatagaacgtagtacgcatattttgtct
acatatattggctctgaattatcaaaaaatagtatattaacttgtgttaaaaatgctttt
aattttccagtcccattagtgtgtataaataataatgttgcaattttagaactttttcat
ggcccaactttggcttttaaagattttggaagccgattaatggcgcaaatgttaaatcag
actaaccattgttctgataaaccaatggttattctgactgctacttctggagatacaggt
gctgctgtagcccatgctttttttaatttaagcaatatacatgttataattctttaccct
agaggcaagattagtgcattacaagaaaaattattttgcactttaggaggcaatatttct
acaatatcagtaaatggagattttgattcatgtcaacgtttagttaagaaagcttttgat
gacagtgtactgcgacagaaattaaatttaaattctgcgaattccattaacattggccga
ttattagctcaaatttgttactattttgaaggggtatcacaattaccgcatcaaatgcgt
aataaattagttattgcggttcctagcggtaattttggaaatttaacagcaggactatta
gctcaatcttgtggattaccagtaaagaagtttattgctgctactaatattaatgatact
gtgcctagatttttagagtttggttattgggaacctcgccctactctttcaacgttttct
aatgctatggatgtaagctctccaaataattggtctagaatagaagaattgtttcgtcga
gaaaataaatctattaaagaattggaatatggttgtgttaatgattttctcaccgagaaa
acagtccaagaaattgcagatttgggatatctttccgaacctcataccgctgtagcatat
cgattactgtgtgataaattacattctgatgaatttggtatatgtcttggtactgctcat
cctgttaaatttaaagagttagtagaggattttttaaaaaaaaagatacaattaatatta
ccaattgtattaaaagaacgtatgaaattacctgttttatcgtttaaaatacctaaatgt
ttctcttcattacgtaacctaattttaagcataatgtcttaa

DBGET integrated database retrieval system