KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_156Help
Entry
BPEN_156          CDS       T00272                                 

Gene name
lpdA
Definition
(GenBank) dihydrolipoamide dehydrogenase, FAD/NAD(P)-binding, E3 component of the 2-oxoglutarate dehydrogenase and the pyruvate dehydrogenase complexes
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
bpn00010  Glycolysis / Gluconeogenesis
bpn00020  Citrate cycle (TCA cycle)
bpn00260  Glycine, serine and threonine metabolism
bpn00280  Valine, leucine and isoleucine degradation
bpn00620  Pyruvate metabolism
bpn00630  Glyoxylate and dicarboxylate metabolism
bpn00640  Propanoate metabolism
bpn01100  Metabolic pathways
bpn01110  Biosynthesis of secondary metabolites
bpn01120  Microbial metabolism in diverse environments
bpn01130  Biosynthesis of antibiotics
bpn01200  Carbon metabolism
Module
bpn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPEN_156 (lpdA)
   00020 Citrate cycle (TCA cycle)
    BPEN_156 (lpdA)
   00620 Pyruvate metabolism
    BPEN_156 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    BPEN_156 (lpdA)
   00640 Propanoate metabolism
    BPEN_156 (lpdA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPEN_156 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    BPEN_156 (lpdA)
Enzymes [BR:bpn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BPEN_156 (lpdA)
Exosome [BR:bpn04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BPEN_156 (lpdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored NAD_binding_8 GIDA 2-Hacid_dh_C FAD_binding_2 HI0933_like FAD_binding_3 Thi4
Motif
Other DBs
NCBI-ProteinID: AAZ40796
UniProt: Q493P1
Position
complement(193981..195405)
Genome map
AA seq 474 aa AA seqDB search
MYIKIKTQILVLGAGPGGYSAAFRCADLGMDTTIVERYPDLGGVCLNVGCIPSKTLLHIA
KLIETQKKFNKYGLLSGETHIDLNKTRSWKDKIIDQLSNSLSAMAKKRNVKVIDGVGKFI
DSHTIQVENNEMTLEIAFNYAIVAAGSHTVSLPCIPNDQRIWNSTDALSLQSIPERLLII
GSGAIGLEMATIYRAFGSEIDIVEMCNRIMPILDEDITNIFTKIITKNINLILNTKVNIV
EAKKDGIYVTMENKQTLLKNTQRYDALLVAIGRAPNGNMLNIERAGVNVNEYGFIPVDKQ
MRTNVQHIFAIGDIIGYPMLAHKSIHEGHVAAEVISGKKRCFDPIIIPSIIYTDPEIAWV
GYTEKSAQEKNIDYEVALFPWMASGRAITEDCKEGITKLIFNKKTNRIIGGSILGANASE
ILGEIALAIEMGCDVEDITLTIHAHPTLYESIALAASIHNGSITDLPNIKKQTQ
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtatataaaaataaaaactcaaattcttgttttaggcgcgggaccaggaggttattcc
gcggcttttcgctgcgctgatttaggtatggatactacaatagtagaacgttatcctgat
ttaggtggagtgtgtcttaatgttggttgtattccgtctaaaacattattacatattgcc
aaattaattgaaacacaaaaaaaattcaataaatatggtctcctgtcaggagaaacacat
atcgatcttaataagacgcgctcttggaaagataaaattattgatcaattgtcaaatagt
ttgagtgctatggcaaaaaaacggaacgttaaagtaattgatggggttggtaaatttatt
gatagtcatactattcaagttgaaaacaatgaaatgaccttagaaatagcattcaattac
gctattgtagcagcaggatcacatactgtatcactaccatgtattcctaatgatcagcga
atttggaattcaactgatgctctatctttacaatcaatacccgaacgtttactaattata
ggctcaggagctataggattagaaatggccacaatatatcgtgcttttggatcagaaata
gatatagtagaaatgtgtaatcgaatcatgccaattttagatgaagatattactaatatt
tttactaaaataattactaaaaatattaatttaattttaaatactaaagttaacatagta
gaagctaagaaagatggtatttatgtaactatggaaaataaacaaactttattaaaaaat
actcaacgttatgatgcattattagtagcaattgggcgcgctccaaatggtaacatgttg
aatatcgagcgtgcgggagtaaatgtaaatgaatatggtttcattcctgtagataagcag
atgcgtactaatgttcaacacatttttgctattggagatattattggatatccaatgcta
gctcataaaagtattcatgaaggacatgtagctgcagaagttatttccggtaaaaaacgt
tgttttgatccaataataattccatccattatatatactgatccagaaatagcgtgggtt
ggatatactgaaaaaagtgctcaagaaaaaaatatagattatgaagttgcacttttccct
tggatggcttcaggtcgagcaattactgaagattgtaaagaaggcataaccaaattaatt
tttaataaaaaaacgaacagaattattgggggatcaatattaggcgcgaatgctagtgaa
atattaggagaaattgcattagccattgaaatgggatgtgatgtagaagatattactcta
accattcatgcccatccaaccttatatgaatcaatagcattagcagcatctattcataat
ggatcaattactgatttgcctaatataaaaaaacaaacacaataa

DBGET integrated database retrieval system