KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_275Help
Entry
BPEN_275          CDS       T00272                                 

Gene name
recD
Definition
(GenBank) exonuclease V, alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
bpn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BPEN_275 (recD)
Enzymes [BR:bpn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BPEN_275 (recD)
DNA repair and recombination proteins [BR:bpn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BPEN_275 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 Helicase_RecD AAA_11 UvrD-helicase DUF2075 AAA_22 UvrD_C Mg_chelatase AAA_29 AAA PIF1 NTPase_1 AAA_28 AAA_24 AAA_16 ResIII GDYXXLXY
Motif
Other DBs
NCBI-ProteinID: AAZ40906
UniProt: Q493D6
Position
complement(316824..318731)
Genome map
AA seq 635 aa AA seqDB search
MKDVINNILKLGLWHSLDVQFADVLALPIYDGNRHNNIKEALILASATLSSKVRDGHVCL
PLRCLTPDKLFQGNYPELTYAIYRKLGKLSISSWQELLFSCPAVSDGSRVTPLILENKRL
YLHHMWQDECIVAQFFNHKYPSNVFQKEKIIYALNQLFPITYTEVDWHKIATAIGVTHHR
VLISGGPGTGKTSIIAKIVATLLLCSKNNDLNIQITAPTGKATALLTESFRTTIHNIPQL
EKLLLCNLPEKATTLHSLLRTRLYKENIQYNCFNLTRLDLLIIDEASMVSLSMLAQLILM
LSPQTKVIFLGDQYQLCSVEPGSVFKDVCQFSNFYYSRKRYQELIDLTGYILPIISPSKS
SMHYNYNSIIDGTCILKKNYRFSESSGINKLSGAINSGDYNHALSLLKSSIYKDLCYIYF
VDKKSYITMILNCAMAYSNYLQKLKYTKILTENILKIFNHYRILCALRDGPFGVIRLNYY
IEQILNEKGLIQLNNSRNYLGRPIIILRNKPSLELYNGDVGVLLLNDQNKLSAYFILPRG
SIKVIQINQLPEHETCFAMTIHKAQGSEFQHTAIVLPNKYIPLLTRELLYTAVTRARQCL
YLYATDHVIIRSVNSITQRYSGLYEKIKNHIIPMA
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgttattaacaatattttaaaattagggttgtggcattcactagatgtacaa
tttgccgatgtattagctcttcccatttatgatgggaatcgacataataatataaaggaa
gcattaattttagctagcgcaactctaagctctaaagttagggatggccatgtttgttta
cctttgcggtgtcttactcccgataaattatttcaaggaaattatcctgaattaacgtat
gcgatatatagaaaattaggaaaattatcgatatcctcctggcaggaattattgttttct
tgtcccgcagttagtgatggatcacgggttaccccattaatattggaaaataaacgtttg
tatttacatcacatgtggcaagatgaatgcatagtcgcgcaattttttaatcataaatat
ccatcaaatgtttttcaaaaagaaaaaataatttatgcattaaatcaattatttcctata
acttatacagaagttgattggcataaaatagctactgctattggcgtaacacatcacaga
gtgctaatttctggaggacctggaactggaaaaacatctattatagcgaagatagtagcg
acattattgttatgtagcaagaataatgatctaaatattcaaataaccgctcccacagga
aaagcaacagctcttttaactgaatctttcagaacaacaatacacaatattccacaatta
gaaaagcttctcttatgtaacttaccagaaaaagctactactctacatagtttgcttaga
acacgattatataaagaaaatattcaatataactgctttaatctcacgcgcttagatctt
ttaattattgatgaagcttctatggttagtctatctatgttagctcagctaattttgatg
ctttctcctcaaacgaaagttatttttttgggtgatcaatatcaattatgttcagtagaa
cccggatccgtatttaaagatgtgtgtcaattttctaatttttattattctcgtaaacgt
tatcaagaacttatagatcttacaggttacatattgcctattatatctccttctaaatca
tctatgcattacaattataatagtattattgatggcacatgtatactaaagaaaaattat
cgatttagtgaaagttcaggaattaataaattatctggtgctataaattcaggagattat
aatcatgcgttatcattgttaaaatcaagcatatataaggatttatgttatatttatttt
gtagacaaaaaaagctatataactatgattcttaattgtgcaatggcatattctaactat
ttacaaaaattgaaatacactaaaatcctgacagaaaatattttaaagattttcaatcat
tatcgaatattatgtgcattacgtgatggcccgttcggagtaataagacttaattattat
attgaacaaatattaaatgagaaaggattaattcaattaaataattctaggaattattta
ggtagacctattattatattacgtaataaaccatcattagaattatataatggagatgtt
ggtgtattgttattaaatgatcaaaataaattgtctgcatattttattttgccacgagga
agtataaaagttatacaaataaatcaattaccggagcatgaaacttgttttgctatgact
atacataaagcgcaaggatctgaatttcaacataccgcaatagtattgcccaataaatat
ataccattattgacacgagaattactctatactgctgtcactagagctcgccaatgcctt
tatttgtacgcgacagatcatgtaataatacgcagtgttaattctatcacacaacgttat
agtggattatatgaaaaaataaaaaaccatataattcccatggcttaa

DBGET integrated database retrieval system