KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_283Help
Entry
BPEN_283          CDS       T00272                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
bpn00900  Terpenoid backbone biosynthesis
bpn01100  Metabolic pathways
bpn01110  Biosynthesis of secondary metabolites
bpn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BPEN_283 (dxr)
Enzymes [BR:bpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BPEN_283 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C DapB_N
Motif
Other DBs
NCBI-ProteinID: AAZ40914
UniProt: Q493C8
Position
328454..329647
Genome map
AA seq 397 aa AA seqDB search
MQSLTILGSTGSIGKATLSVIQQHTDKFFVHALVAKNNVAIMTEQCIAMSPKYACMISED
AARILKKNLITAGKYDIEVLSGVMHACELASTNDVDMVMSAIVGIAGLKPTFSALRAGKK
ILLANKETLVTGGKLFMKEANRYRACILPIDSEHNAIFQNLPEICQKSLGNTSLSECGIS
RIVLTASGGIFFKTPQKQLTKITPEQACVHPNWSMGRKISVDSATMMNKGLEYIEARHLF
NAKPSEIEILLHPQSIVHAMVYYSDGNVLAHLAPPDMRIPIAYAMAYPKRIGLKISSNID
IYYLNKLHFDQLDNCSYPCFQLAIDADNCSQSATIILNAANEIAVEAFLRKMISFTDIPD
VIRRVLDAINLNDPNDIEDILYIDQKAREKAISICVI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctttaacaattttaggtagtactggatctattggaaaagctaccctatctgta
atacaacaacacaccgataagttctttgtgcatgcattagtcgcgaaaaataacgttgct
atcatgacagaacagtgcatagcgatgtctcccaaatatgcatgtatgatatctgaagat
gcagcacgaatattgaaaaaaaatttaatcaccgctgggaaatatgatattgaagtatta
tctggggtgatgcatgcctgtgaattagcatcaactaatgatgtggatatggtgatgtct
gccatagttggaattgctggattaaagcctactttttccgcgttgcgtgctggtaaaaaa
atattattggcaaataaagaaactttagttactggcggaaaattgtttatgaaagaagcc
aatcgataccgtgcctgtatactgcctatagatagcgaacataacgcaatttttcaaaat
ctaccagagatatgtcagaagagtttaggaaatacatctttatctgaatgcggtatatct
cgtattgtgctaactgcatctggaggaattttcttcaaaacgccacaaaaacaattaacc
aaaataacaccagagcaggcttgtgtgcatcctaattggtccatggggcgtaagatatca
gtagattctgctactatgatgaataagggattagaatatattgaagcacgtcatttattt
aatgctaaaccaagtgaaatagaaattttattacatcctcagtctattgtccatgctatg
gtatactattccgacggaaatgtattggcgcatttagcacctccagatatgagaattcct
attgcgtacgcaatggcatatcctaaaagaataggactaaaaatctcatctaatatagac
atatattatcttaataaattacattttgatcaattagataattgcagttatccttgtttt
caattagcaatagatgctgataattgtagtcaatcggctactattatcctgaacgcagca
aatgaaatcgccgtagaagcatttttacgtaaaatgatttcttttactgacattcctgac
gtcattcgtcgtgtacttgatgcaataaatttaaatgatcctaatgatatagaagatatt
ttatatattgatcaaaaagctcgtgagaaagcaatatctatatgtgtcatataa

DBGET integrated database retrieval system