KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_441Help
Entry
BPEN_441          CDS       T00272                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerolphosphate synthetase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
bpn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpn01100  Metabolic pathways
bpn01110  Biosynthesis of secondary metabolites
bpn01130  Biosynthesis of antibiotics
bpn01230  Biosynthesis of amino acids
Module
bpn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPEN_441 (trpC)
Enzymes [BR:bpn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BPEN_441 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     BPEN_441 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AAZ41060
UniProt: Q492N7
Position
522007..523380
Genome map
AA seq 457 aa AA seqDB search
MQHTILDKILSYKKMWIADQKKQHSLHFLKSKIQASNRDFYSAVSRNKYQKTIFILECKK
ASPSKGIICNDFDPIKIAQTYKNYSSVISVLTDNKYFHGNFNILHQVSNIVKQPILCKDF
FISEWQIYFARLHKADAILLMLSILDDASYQKLVKIAHTLCMGVLTEIANEDELKRAKYL
GAKVIGINNRNLNDLSVDLNRTITLSKDIPNTITVISESGISNYCHIRKLRRYVNGFLIG
TILMSQPKLNAAIKKLILGENKICGLTRVRDADIAYKSGAIYGGLIFVPTSPRYINITIA
QRIVSCVKYLSYVGVFCNAPISYIVTIVNILGLAAVQLHGVEDQDYINILRTRLPITCHI
WKSINMNHRPLSKCNILNVDRYLADSGGGSGKTFDWSLLSSMQLDKVILAGGLTINNCNK
AAGIGCLGLDFNSGVEIKPGIKNHQKLIKVFQIIRSY
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacacaatactcgataaaattttatcatataaaaaaatgtggatagctgatcaa
aaaaaacaacattcattacattttttaaaaagtaaaatacaagcaagcaatcgtgatttt
tatagcgctgtgtctcgcaataaatatcaaaaaacaatatttatattagaatgtaagaaa
gcgtctccttctaaaggtattatttgtaatgattttgatcctatcaaaatagcacagact
tataaaaattactcctcagtgatatcagtattaactgataataaatactttcatgggaat
tttaatattttacaccaagtgagcaacatcgtaaaacaaccaatattatgtaaagatttc
tttatttcagaatggcaaatttattttgcgcgcttacataaagctgatgctattttacta
atgctatcaattctagatgatgcatcctatcaaaaattggtcaaaatagctcatacatta
tgtatgggggtactaacagaaatcgcaaacgaagatgaattaaagcgcgctaaatattta
ggagctaaagttatcggtataaataatcgtaatctgaatgatttgtccgttgatttaaat
cgcactattactctaagtaaagatatacctaatacaatcactgtaatcagcgagtctggt
attagcaattattgtcatataagaaaacttagacgatatgttaatggatttttaataggt
acaatattaatgtctcaaccaaagcttaatgcagccattaaaaaattaattttaggagaa
aataaaatatgtggactaactcgagtgagagacgctgatattgcatacaaatcaggcgca
atatatggagggctaatttttgttcccacttcacctcgctacataaatatcacaattgcg
caacgtattgtttcttgtgtaaaatatttaagttatgttggtgtattttgtaatgctcca
atttcttatattgttaccatagttaacatattaggactagcagcagttcaacttcatggc
gtagaagatcaagattatattaatattttacggacacgattacccataacatgtcatata
tggaaaagtattaatatgaatcacagaccattgtcgaaatgtaatatactgaacgtagac
cgctatttagcagacagtggagggggtagtggaaaaacttttgattggtcactgctttct
agcatgcaattagataaagtaattttagccggaggattgacaataaacaattgtaataaa
gcggcgggcataggttgtttaggtttagattttaattctggagttgaaattaaaccaggt
attaaaaatcaccagaaactcatcaaagtcttccaaataatcaggtcttattaa

DBGET integrated database retrieval system