KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_637Help
Entry
BPEN_637          CDS       T00272                                 

Gene name
dfp
Definition
(GenBank) 4'-phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
bpn00770  Pantothenate and CoA biosynthesis
bpn01100  Metabolic pathways
Module
bpn_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bpn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BPEN_637 (dfp)
Enzymes [BR:bpn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     BPEN_637 (dfp)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     BPEN_637 (dfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PspC
Motif
Other DBs
NCBI-ProteinID: AAZ41235
UniProt: Q491W9
Position
760593..761801
Genome map
AA seq 402 aa AA seqDB search
MTGLINKHIILGVSGGIAAYKTIDLVRCLKEQGSEVRVIMTKSAKKFVTPLSLQTISCHP
VLDNFLTPQIETTMPHIKLAKWADLVLLAPATANLLARLSVGLANDLLCSLCLATTAPIA
VAPSMNQQMYKAIATQTNLDILRKRGVLIWGPDYGCQACNDIGYGRMTDPKVLSEYVKHY
FSHDSSLSHLNIMITAGPTHEALDPVRFFTNYSSGKMGFAIAQAAADKGAKVTLITGPVN
LRTPIRVQRINVISALDMQEAVMRDISNQQIFIGCAAVSDYRICHVSLDKIKKNKNTLKI
IMVKNPDIVAKVGSLIENRPYVVGFAAETNNIQKYAQDKRISKHLDLICANNISRINQGF
NSDNNALYLFWNKGSVILPLRKKKLLAQQLINEIIDRYNENN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacgggattaattaataaacatatcatattaggagtaagcggtggtatcgcagcatat
aaaactatagatcttgtacgatgtttaaaagaacaaggttcagaagtgagagtgataatg
acaaaatctgcaaaaaaatttgttacccccttaagtttacaaacaatatcgtgtcatcca
gttttggataattttcttacccctcaaatagaaaccacaatgcctcacataaagttagct
aaatgggctgatttagttttacttgctccggctacagccaatttattagctagattatct
gtaggattagctaatgatttattatgtagtttatgtttagctacaacagctcctattgct
gtagctccatctatgaatcaacaaatgtataaagctattgcaactcaaacaaatttagat
attctacgaaaaagaggagttttaatatggggtccggattacggatgtcaagcttgtaat
gatattggttatggacgcatgacggaccccaaagtactttctgaatacgtaaaacattac
ttttctcatgatagttctttaagtcatcttaatatcatgattactgctggtcctactcac
gaagccttagatcccgttcgtttttttactaattatagttcaggaaaaatgggatttgct
atcgctcaagccgctgcagataaaggagcaaaagttacattaattacaggtccggtgaac
ttacgtactcctattcgagtgcaacgtattaatgttatttccgctttagacatgcaagaa
gcagttatgcgagacattagtaatcaacaaatttttatcggttgtgcagcggtatcagat
taccgcatttgtcatgtttctcttgacaagattaaaaagaataaaaatactttaaaaata
attatggttaagaaccccgatattgtggcgaaagtagggtcgttaattgaaaaccgtcct
tatgtcgttggatttgccgctgaaactaataatatacaaaaatatgctcaagataaacgt
attagtaaacatttagatttaatttgtgctaataatatttctcgtataaaccaaggattc
aatagtgataataatgctttatatttattttggaataaaggaagcgttatattgccttta
agaaaaaaaaaattgttagcacaacaacttattaacgaaattattgatcgttataatgaa
aataattaa

DBGET integrated database retrieval system