KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_641Help
Entry
BPEN_641          CDS       T00272                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
bpn00230  Purine metabolism
bpn01100  Metabolic pathways
Module
bpn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BPEN_641 (gmk)
Enzymes [BR:bpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BPEN_641 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin Adeno_IVa2 AAA_31 AAA_29 NTPase_1 Baculo_PEP_N AAA_22 AAA_16 AAA_19 AAA_30
Motif
Other DBs
NCBI-ProteinID: AAZ41239
UniProt: Q491W5
Position
765594..766232
Genome map
AA seq 212 aa AA seqDB search
MKNSGILCIISAPSGTGKSTLIHTVIQCDCFVYQTKLSISYTTRIKRPGEIHGKDYYFIS
KKKFKYMIDKNMFFEYAMIFNHYYGTAKTDIETMLNTGIHIVLNIDWKGAQQIRSKISKN
IYTIFILPPSKKELARRLYLRGEDTEKVIVARMGQAMDEISHFKEYDYIIINDNFNIALM
HLQSIMLSEQLRIAHQKIRYATLINHLLLPDI
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaggaatattgtgtattatatccgctcctagtgggacaggaaaatctacg
ttaattcatactgtgatacaatgtgattgctttgtttatcaaactaaactatctatttcc
tataccacacgtatcaaaagacctggagaaatacacggaaaagattattattttatttca
aaaaaaaaatttaaatatatgatcgataaaaatatgttttttgaatatgcgatgattttt
aatcattattatggtaccgcaaaaactgatattgaaacgatgttaaatactggtatacat
attgtgctgaatattgactggaaaggagcgcaacaaattcgcagtaaaatatcaaaaaac
atctatactatttttattttgcctccatcaaagaaagaattagcacgtcgattgtatcta
agaggagaagacacagaaaaagtgattgtcgcgcgcatgggccaagcaatggatgaaatt
agccattttaaagaatatgattatattatcataaacgataattttaacattgctttgatg
catttacagtcaattatgttatccgagcaattgcgaatagcgcatcaaaaaatacgctac
gcaacattaatcaatcatttgttattgccagatatataa

DBGET integrated database retrieval system