KEGG   Brachyspira pilosicoli 95/1000: BP951000_0095Help
Entry
BP951000_0095     CDS       T01278                                 

Gene name
nagA
Definition
(GenBank) putative N-acetylglucosamine 6 phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
bpo00520  Amino sugar and nucleotide sugar metabolism
bpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BP951000_0095 (nagA)
Enzymes [BR:bpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BP951000_0095 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 Glucosamine_iso Glyco_hydro_79n
Motif
Other DBs
NCBI-ProteinID: ADK30104
UniProt: D8I9Y7
Position
complement(102234..104198)
Genome map
AA seq 654 aa AA seqDB search
MRIIITNESVYEWAAYYTVKCILDYSDRKKPFVLSFPLRYVDKSYYEKLLSFYNDNIVSF
KNIHIVSSGEYIDSDISQKYLEENFIKHIDIPKENVHLFNSRATDRKKEARRMSNIIKKL
GNITLLIDNLAEDGSFLLNTPSSSLEGSVRDKKISEIIRSYEAKKFNMPVEMFPREGLTL
GFEEAFNAKYILVMANGYDVSDALSHCVEGAISQFYPTSVLQEHKKLIIVADEESSSDLK
VKTYKYAKSLESKNLHPKELIKGLYKSYYALTNIRIFDGEKFIDGHCIVIENNIIKSVEK
EIDVDAVITRIDLGGKIVAPGYIDLQVNGIGGYDINASPTVDTLKNMNEVCQRYGCTSYL
PTVITNGDEYMLKIIDLFNSIEDLSVIGVLGIHFEGPYISHEKRGIHNEKFIREADMNMI
KKINASKCVMVTVAPEMVDGKVIEAFAKAGKVVSVGHTNGTYNEIKEKIPYGITFATHLF
NAMRPWGSREPGAVGAVLETKDMYAGLICDGVHCDFASVELAYKLKTGHICIVTDAIAPA
AAPEIKEYIWAGKKIHRDGNRLIDDNGTLGGASITMSQSVRNVVNQVGATVEEALKMASL
YPAKVMGIDDKYGRIKEGYIADLVVLDEKLVVKGVVFKGNYKEYNYDYEWESNA
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcattataactaatgaaagtgtttatgaatgggcagcatattatactgtaaaa
tgtatattagattattctgatagaaaaaaaccttttgtattatcttttcctttgaggtat
gtggataaatcttattatgaaaaattattgtctttttataatgataatatagtatcattt
aaaaatatacatatagtttcttcaggcgaatatatagattcagacatatctcaaaaatat
ctagaagaaaattttataaaacatatagatatacctaaagaaaatgtacatttgtttaat
agcagagcaacagacagaaaaaaagaagctagaagaatgtcaaatataattaaaaaactt
ggaaatataacattgctaatagataatttggcggaagatggaagtttcttgttaaatact
ccaagctcatcattagaaggaagtgtaagagataaaaagataagcgagataattagaagc
tatgaagcaaaaaaattcaatatgcctgtagagatgtttccaagagaaggacttactctt
ggttttgaagaggcttttaatgcaaaatatatacttgttatggccaatggttatgatgta
tctgatgctttgtctcattgtgttgaaggagcaataagtcaattctaccctacttcagtt
ttacaggaacataaaaaacttataattgtagcagatgaagagtcaagcagcgatttgaaa
gtaaaaacttataaatatgctaagagcttagaaagtaaaaatcttcacccaaaagagctt
atcaaaggtctttacaaatcttattatgctcttacaaatattagaatatttgatggtgag
aagtttatagacgggcattgtatagtaatagaaaacaatattattaagagtgtagaaaaa
gagatagatgttgatgctgtaattacaagaatagatttgggaggaaaaatagtagctcct
ggatatatagatttgcaagttaatggtataggaggctatgatattaatgctagtcctaca
gttgatacattaaaaaatatgaatgaagtttgccagagatatggctgtacttcttatttg
cctactgtaataacaaacggcgatgaatatatgctaaagattatagatttatttaatagt
atagaagatttgtcagttattggagtgcttggcatacattttgaaggaccttatatatct
catgaaaaaagaggtattcataatgagaagtttataagagaagcagatatgaatatgata
aaaaagataaatgcttcaaaatgtgttatggtaacagttgctccagagatggtagacggt
aaagtgatagaagcatttgctaaggctggaaaagtggtatctgtaggccatacaaacggc
acttacaatgaaataaaagaaaaaataccttatggaatcacttttgcaacgcacttattt
aatgctatgcgtccttggggttctagagagcctggtgctgttggtgctgtgcttgaaact
aaggatatgtatgctggtttgatatgtgatggagtgcattgtgattttgcttctgtggag
cttgcttacaaattaaagacagggcatatttgtattgtaactgatgctatagctcctgct
gctgctccagagataaaagaatatatttgggctggcaaaaaaatacatagagatggaaat
aggcttatagatgataatggtactttgggaggggcttctattactatgagtcagtctgta
agaaatgttgttaatcaggtaggtgctacagttgaagaggctttaaagatggcttcactt
tatcctgctaaggttatggggatagatgataaatatggaaggattaaagagggatatatt
gccgatttagttgttttagatgaaaagttggttgtaaaaggtgttgtatttaagggtaat
tataaagaatataattatgattatgaatgggaaagtaatgcataa

DBGET integrated database retrieval system