KEGG   Brachyspira pilosicoli 95/1000: BP951000_0870Help
Entry
BP951000_0870     CDS       T01278                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
bpo00010  Glycolysis / Gluconeogenesis
bpo00030  Pentose phosphate pathway
bpo00051  Fructose and mannose metabolism
bpo00680  Methane metabolism
bpo01100  Metabolic pathways
bpo01110  Biosynthesis of secondary metabolites
bpo01120  Microbial metabolism in diverse environments
bpo01130  Biosynthesis of antibiotics
bpo01200  Carbon metabolism
Module
bpo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP951000_0870
   00030 Pentose phosphate pathway
    BP951000_0870
   00051 Fructose and mannose metabolism
    BP951000_0870
  Energy metabolism
   00680 Methane metabolism
    BP951000_0870
Enzymes [BR:bpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BP951000_0870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos Metallophos_2 Binary_toxB_3
Motif
Other DBs
NCBI-ProteinID: ADK30868
UniProt: D8ICJ5
Position
complement(975420..977363)
Genome map
AA seq 647 aa AA seqDB search
MKDKDYLELLSQKYPTIDDASVEIINLKAICKLPKGTEYFLSDIHGESEGFEYLIGTSSG
VIKEKIEILFRNTLTENERIELQILIVDTKNMINKKASKEDFNDWCRITIYRLIRICKLV
TSKYTRSKIRKKMPQNFAYILDELLQTSVEDNKENYYFSIIDSIIDVSASEKFIMALCAL
IRKCSIDRLHIVGDIYDRGPHPDKVIESIMNFNEVDMAWGNHDIHWLGAAKGSLICVANA
VRLAVRYNNFDLLEYSYGINLRALSSFANEVYKDDPCEVFKLNTLDKNIYDEVDKDLASK
MHKAISIIQFKLECQLIKRHPNYAMDERILLDKIDYKKGTINIDGKTYELKDKNFPTINP
KNPFELTEGENTLIQSLAFSFINSPTLQKHTNYIYAKGGIYKIFNGNLLYHGCIPTKEDG
SFDDVYIDGQYLSGKRYLKQVEDKVRKAFYCEVGSEEQLNALDYCWYLWCGPKSPLFGKN
KMTTFERYFIEDKETHKESYNSYYYHIDKKDYCESILKEFDLDIHKSHIVNGHVPVKTHK
GESPIKGGGILLVIDGGLSKAYHKSTGIGGYTLISNSNAMIIAEHRPFAEVVESGFRISP
KTTIVDRFVTRITVGETDIGIGLNKRISDLEELLNAYRNGIVKEKVN
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaggattatttagagttattatctcaaaagtaccccactatagacgatgct
tctgttgaaattattaatttaaaagctatatgcaaattaccaaagggtactgagtatttt
ttaagcgatatacatggagaatctgaaggctttgaatatttaataggtacttcatctggt
gttataaaagagaaaatagaaatattatttagaaatactttaacagaaaatgagagaata
gaacttcaaatacttatagtagatacaaagaacatgattaataaaaaagcatctaaagaa
gattttaatgattggtgcagaataactatatacagacttattagaatatgcaagcttgtt
actagcaaatatacaaggtcaaagattagaaagaagatgcctcagaactttgcttatata
cttgatgaacttttacaaacatctgttgaagacaataaagagaattattatttttctata
atagattctataatagatgtgtcggcatcagaaaagtttattatggcattatgtgctttg
ataagaaaatgcagtatagacaggcttcatattgtaggtgatatttatgacagaggacct
cacccagataaggtaattgagagtataatgaactttaatgaagttgacatggcttggggc
aatcatgatatacattggcttggggctgctaagggtagtttaatttgtgttgctaatgct
gttcgtttggctgtgagatataataattttgatttgcttgaatatagttatggtataaat
ttaagggctttatcatcatttgctaatgaggtttataaagatgacccttgcgaagtgttt
aaacttaatactctagataaaaatatatatgatgaggttgataaagatttagcttcaaag
atgcataaggctatatcaataatacagtttaaattggaatgtcagcttataaaaagacac
ccaaattatgctatggacgaacgtatacttcttgataagattgattataaaaaaggcact
attaatattgacggtaaaacctatgagcttaaagataaaaactttccaacaataaatcct
aaaaacccttttgagcttacagaaggagaaaatactttaatacagagtttagctttttct
tttatcaatagcccaacacttcaaaagcatactaattatatttatgctaaaggcggaata
tataaaatatttaatggaaatcttctttatcatggatgcatacctacaaaagaagacggc
agttttgatgatgtatatatagacggacaatatttatctggaaagagatatttaaagcaa
gttgaagacaaggtacgtaaagcattttactgcgaagttggaagcgaagaacagcttaat
gctttggattattgctggtatttatggtgcggtccaaaatctccattattcggtaaaaat
aaaatgacaacctttgaaagatattttatagaagataaagaaactcataaagaaagttat
aattcatattattatcatatagacaaaaaagattattgcgagagcatattaaaagagttt
gatttggatatacataaatcgcatatagttaatggtcatgtacctgtaaagactcataaa
ggtgaaagcccaattaaaggcggtggaatacttttagtaatagacggaggactttctaag
gcttatcataaaagcacaggcataggaggttacactttaatatcaaactcaaatgccatg
attatagcagagcatagaccttttgctgaagtagtagaatccggttttagaatatctccg
aaaacaactatagtagatagatttgtaactagaattacagtaggtgaaactgatattggt
attggcttaaacaaaagaataagtgatttggaagaattactcaatgcatatagaaacggt
atagtaaaagagaaggtaaattga

DBGET integrated database retrieval system