KEGG   Brachyspira pilosicoli 95/1000: BP951000_0935Help
Entry
BP951000_0935     CDS       T01278                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductase alpha subunit-like protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
bpo00010  Glycolysis / Gluconeogenesis
bpo00020  Citrate cycle (TCA cycle)
bpo00620  Pyruvate metabolism
bpo00640  Propanoate metabolism
bpo00650  Butanoate metabolism
bpo00680  Methane metabolism
bpo01100  Metabolic pathways
bpo01120  Microbial metabolism in diverse environments
bpo01130  Biosynthesis of antibiotics
bpo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP951000_0935
   00020 Citrate cycle (TCA cycle)
    BP951000_0935
   00620 Pyruvate metabolism
    BP951000_0935
   00640 Propanoate metabolism
    BP951000_0935
   00650 Butanoate metabolism
    BP951000_0935
  Energy metabolism
   00680 Methane metabolism
    BP951000_0935
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BP951000_0935
Enzymes [BR:bpo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BP951000_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ADK30933
UniProt: D8ICR0
Position
complement(1044781..1047045)
Genome map
AA seq 754 aa AA seqDB search
MAQKYNLAEQENILESGNELAAIAAAQINYHVMGYYPITPSTQIAEYLDEMKANGRHTVC
MIPGDGEHGAAGICYGATTAGGRVFNATSANGLLFAMEQLPVQAGTRFPMVLNVVNRTVS
GPLDIKCDQSDIMMALNTGWIIIMAHTTQMVYDFNIFALKIAEKAKLPIIVSSDGFFTSH
QKKKIHLFKNDKDVQDFLGKYTPEVTSVEPTKNPVTIGPYMNEDELTGSKLQLSQALEDS
RAIIAEVFEEFASLSGRKYSPIETHNMEGAEVALMLCGSAYETGTLAVDEMRKANPNLKI
GAFAITQIRPFPEKELQKLLANVKVVVVGDRQDTYSGMGGNMSTEIRAALKNDPNNKSSI
VSRVYGLGGTEFTLDKAKELFELGLKELAKAGSVEKHSYLEQYMGDPNVKMKPIHEPLTL
ESQKSGITVTMNEQTHKLDVKVPPLRELTGKAYRYAQGHGACNGCGIFSGINTFMKGIEG
SVVLLVHTGCSMVVTTGYPYSSYRTTYVHNLFQNGAATLSGIVEMYHERKRRGEIDGPED
PTFIMVTGDGGHDIGMGPSIGAAIRNHKMIILEYDNEGYMNTGNQLSFSTPLGHRTSTSN
VGKAEVGKQFGHKDVAQIFNGCHIPYIATGCEAYPLDLVKKAAKAQWYANNVGTAFVKLL
ITCPLNWKTPDDMGKDIIKAAVDCCFFPLYEVEQGITTITNMVADDKKQPVTEWLKLMGK
TKHLLKHQDILDKFQADVDNRWARLKAMHESPVL
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaaatataatcttgctgagcaagaaaacatacttgaaagtggtaatgaatta
gcagccattgcagccgctcaaatcaattatcacgttatgggttactacccaatcactcca
tctactcaaattgctgagtacttagatgaaatgaaagctaatggcagacatactgtttgc
atgattcctggtgacggtgaacatggtgcagctggtatctgttatggtgctactactgca
ggaggaagagtattcaatgctacttctgctaacggtttactttttgctatggaacaatta
cctgttcaagctggtactagattccctatggtattaaacgttgtaaacagaactgtttct
ggtccattagatattaaatgtgaccaatctgacataatgatggctcttaacactggttgg
attatcattatggctcatactactcagatggtttatgacttcaatatatttgcattaaaa
attgctgagaaagctaaacttcctatcattgtttcttctgacggattctttacttctcac
caaaagaaaaaaatccaccttttcaaaaatgataaagatgttcaagatttcttaggtaaa
tatactcctgaagttacttctgttgagcctactaagaaccctgttactattgggccttac
atgaatgaagacgaattaacaggtagtaaattacaactttctcaagctttagaagattct
agagctattattgctgaagtatttgaagagtttgcttctctttctggaagaaaatactct
cctatagaaactcataacatggaaggagctgaagttgctttaatgctttgcggttctgct
tatgaaactggtactttagctgttgatgaaatgagaaaagctaatcctaatcttaaaatt
ggtgctttcgctattactcagattcgtcctttccctgaaaaagaattacaaaaattactt
gctaatgttaaagtagttgttgtaggtgatagacaagatacttattctggtatgggcggt
aatatgtctactgagattagagctgctcttaaaaatgaccctaacaacaaatcttctatt
gttagcagagtttatggtcttggcggtactgagtttactcttgacaaagctaaagaatta
tttgaattaggtttaaaagaattagctaaagctggttctgttgaaaaacactcttattta
gaacaatatatgggtgaccctaatgttaaaatgaaacctatacatgaacctttaacttta
gagagccaaaaatcaggtatcactgttactatgaacgaacaaactcataaacttgatgtt
aaagttccacctcttagagaattaactggtaaagcttatcgttatgctcaaggtcatggt
gcttgtaacggttgtggtatattctctggtatcaatactttcatgaaaggtatagaaggt
tctgttgtacttttggtacatactggttgttctatggttgttactactggttatccttac
agctcttatagaactacttatgttcacaacttgttccaaaacggtgctgctactctttct
ggtattgtagaaatgtatcatgagagaaaaagaagaggagaaattgacggaccagaagat
cctacattcataatggttactggtgacggtggtcatgatataggtatgggaccttctatt
ggtgctgctattagaaatcacaaaatgattatcttagaatatgataatgaaggatacatg
aacactggtaaccaattatcattctctactccattaggacatagaacttctacttctaac
gttggtaaagctgaagttggtaaacaattcggtcacaaagacgtagctcaaatatttaat
ggttgtcatataccttatattgctactggttgtgaagcttatcctttagatttagttaaa
aaagctgctaaagctcaatggtatgctaataacgttggtactgctttcgttaaacttctt
atcacttgtccattaaactggaaaactccagatgatatgggtaaagatattattaaagct
gctgttgattgttgtttcttcccattatatgaggttgaacaaggtatcactactatcact
aatatggtagctgatgacaaaaaacaacctgttactgaatggttaaaattaatgggtaaa
actaagcaccttcttaaacatcaagacatacttgataaattccaagcagatgttgataac
agatgggctcgcttaaaagctatgcatgaaagtcctgttctataa

DBGET integrated database retrieval system