KEGG   Brachyspira pilosicoli 95/1000: BP951000_0936Help
Entry
BP951000_0936     CDS       T01278                                 

Gene name
porG
Definition
(GenBank) pyruvate oxireductase
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
bpo00010  Glycolysis / Gluconeogenesis
bpo00020  Citrate cycle (TCA cycle)
bpo00620  Pyruvate metabolism
bpo00640  Propanoate metabolism
bpo00650  Butanoate metabolism
bpo00680  Methane metabolism
bpo01100  Metabolic pathways
bpo01120  Microbial metabolism in diverse environments
bpo01130  Biosynthesis of antibiotics
bpo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP951000_0936 (porG)
   00020 Citrate cycle (TCA cycle)
    BP951000_0936 (porG)
   00620 Pyruvate metabolism
    BP951000_0936 (porG)
   00640 Propanoate metabolism
    BP951000_0936 (porG)
   00650 Butanoate metabolism
    BP951000_0936 (porG)
  Energy metabolism
   00680 Methane metabolism
    BP951000_0936 (porG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BP951000_0936 (porG)
Enzymes [BR:bpo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BP951000_0936 (porG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4_6 Fer4_7 Fer4 Fer4_2 Fer4_9 Fer4_21 Fer4_10 Fer4_17 Fer4_8 Fer4_4 BRCT Fer4_16 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADK30934
UniProt: D8ICR1
Position
complement(1047060..1048028)
Genome map
AA seq 322 aa AA seqDB search
MGANSAGKMLAEVGVLTQGFYGAAFSSYGSEKKGSPVKSFVRFSETEVRVNSTVEEPHVV
AVFHMNLLKNPLTLAGVKEDAIVIFNTNKTPDEARDFAKLHGGKVVCIDAIKIANDLKLP
SQAANTIIMGAMVNQLDFIDSAKFEEQIRKQFGGRKAELVEPNIEAFRKGGSESVVKEFK
ADGKYPYIPYKKPEPVYGKNNQLTGGYINAAGNSTLKDLQVTRTGNIPVFNPANCIDCAN
CEVVCPDLCIVWEKGPDRKDPNKTAMNMMGIDYQYCKGCLKCVRACPKGPYSGKFEKDQQ
ALRIEVEANCDVDKLTYRRYKK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctaatagtgctggtaaaatgcttgcagaagtaggcgttttaacacaaggtttc
tatggtgctgcattctcaagttatggttcagaaaagaaaggttctccagtaaaatctttt
gtaaggttttcagaaactgaagttagagtaaactctactgtagaagaaccacatgtagtg
gcagtgttccacatgaatcttctaaaaaaccctcttacattagctggtgttaaagaagat
gctattgttatttttaacactaataaaacacctgatgaggcaagagattttgctaaatta
catggcggtaaagtagtttgtattgatgcaataaaaatcgctaatgatttaaaacttcct
tcacaagctgctaatactatcataatgggtgctatggttaatcagcttgatttcatagat
tctgctaagtttgaagagcaaatcagaaaacaattcggcggaagaaaagctgaattagtt
gagccaaatattgaagctttcagaaaaggcggaagtgaatctgttgttaaagaattcaaa
gctgacggaaaatatccttatattccttataaaaaaccagaacctgtatatggtaaaaat
aaccaattaacaggcggttatatcaatgctgctggtaactctactttaaaagatttacaa
gttactcgtactggtaatatacctgtattcaatcctgctaactgtattgattgtgctaac
tgtgaagttgtttgtcctgacctttgtatcgtttgggaaaaaggaccagacaggaaagac
cctaataaaactgctatgaatatgatgggtatagattatcaatactgtaaaggttgttta
aaatgtgttagagcttgccctaaaggaccttattctggtaaatttgaaaaagatcagcag
gctttaagaatagaagtagaagctaattgtgatgttgataaacttacatacagacgttat
aaaaaataa

DBGET integrated database retrieval system