KEGG   Brachyspira pilosicoli 95/1000: BP951000_1568Help
Entry
BP951000_1568     CDS       T01278                                 

Definition
(GenBank) aromatic amino acid beta-eliminating lyase/threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
bpo00260  Glycine, serine and threonine metabolism
bpo01100  Metabolic pathways
bpo01110  Biosynthesis of secondary metabolites
bpo01120  Microbial metabolism in diverse environments
bpo01130  Biosynthesis of antibiotics
bpo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BP951000_1568
Enzymes [BR:bpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BP951000_1568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Phage-tail_1
Motif
Other DBs
NCBI-ProteinID: ADK31550
UniProt: D8IEH7
Position
complement(1702831..1703859)
Genome map
AA seq 342 aa AA seqDB search
MRVYDLRTDTITKPSDEMRKAIYKAECGDDVYMEDPTVNKLQDMAAEITGKEKAIFVSSG
TMGNLIPLLILSSKTRQILLEEESHIVHYELGGVAALAGVLPLPVKAKRGILTKSIIEDY
FSPQPYYMSNVNIVEVENSHNRHGGSVYPIEVLKELYSFTKSKNVHMHMDGARVFNASIA
SKASVKEIASNTDSITFCLSKGLGAPMGAMLCGKKEFIDEAFKIRKLIGGGLRQIGLMAA
AGIYALENNIDSLEEDHIKAKKIASAVIESKLGELSLDEVETNIVIAKTQKKSIELVNKL
LEKGIKASSFGDYKLRFVTHRDISMKEVEEACDIIKSFKNNI
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagagtttatgatttaagaacagacacaataacaaagcctagcgatgaaatgcgtaaa
gcaatatataaagcagaatgcggcgatgatgtttatatggaagaccctacagtaaataaa
cttcaagacatggcagcagaaattacaggaaaagaaaaagcaatatttgtttcaagcggt
actatgggtaatttaatacctttattaatattatcttcaaaaacaagacaaatacttttg
gaagaagaatctcatattgtacattatgaacttggaggagtagctgcattggctggtgtt
ttgcctttgccagtaaaagctaaaagaggaatattaacaaaatctataatagaagattat
ttttctcctcagccttattatatgtctaatgtaaatatagtagaagttgaaaacagtcat
aatagacatggaggaagcgtatacccaatagaggttttaaaagaattatatagttttaca
aaatcaaaaaacgtgcatatgcatatggacggagcgagagtatttaatgcttctattgct
tcaaaagcttcagtaaaagaaatagcttctaatacagattctatcacattttgtttgtca
aaaggactcggtgcacctatgggagctatgttatgcggaaaaaaagagtttatagatgag
gctttcaaaattagaaagttaataggaggcggattaagacagattggtttgatggctgct
gctggaatatatgctttagaaaataatatagactcattagaagaagaccacataaaagcc
aaaaaaatagcttctgctgtaattgaatcaaaattgggtgagttgagtttagatgaagtt
gaaactaatattgttatagcaaaaacacaaaagaaatcaatagaattagtaaataaactt
ttggaaaaaggaataaaagctagttcttttggtgattataaattaaggtttgtaactcat
agagatattagcatgaaagaagttgaagaagcttgtgatataataaaaagctttaaaaat
aatatttaa

DBGET integrated database retrieval system