KEGG   Brucella pinnipedialis B2/94: BPI_I1101Help
Entry
BPI_I1101         CDS       T01589                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bpp  Brucella pinnipedialis B2/94
Pathway
bpp00020  Citrate cycle (TCA cycle)
bpp00620  Pyruvate metabolism
bpp00650  Butanoate metabolism
bpp01100  Metabolic pathways
bpp01110  Biosynthesis of secondary metabolites
bpp01120  Microbial metabolism in diverse environments
bpp01130  Biosynthesis of antibiotics
bpp01200  Carbon metabolism
Module
bpp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPI_I1101
   00620 Pyruvate metabolism
    BPI_I1101
   00650 Butanoate metabolism
    BPI_I1101
Enzymes [BR:bpp01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     BPI_I1101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF LUD_dom CoA_trans
Motif
Other DBs
NCBI-ProteinID: AEK54374
Position
1:complement(1053029..1054519)
Genome map
AA seq 496 aa AA seqDB search
MLEARIRNSSLRNKVITAEQAASFIKDGMIVGMSGFTRAGDAKAVPVAMAARAATDPFQI
TLITGASLGHDVDKLLTEAHILSRRMPFQADRTLRSAINRGEVMFIDQHLSETVEQLRSN
QIGPIDCAVVEALAITESGGIIPTTSVGNSASLAILAEKVIVEVNLNQPMALEGLHDIYI
PTKRPSRDPIPIMACDSRIGLPYIPIAPEKIAGIVITQENDSASPVEPADHETVAIAGHL
IEFFKGEVVKGRLDLALNPLQAGIGTIANAVLTGFADSPFHNLRMYSEVLQDSTFDLFDA
GKLDFASGSSITLSPACGERVFNNIDRYRDRLVLRPQEISNHPEVIRRLGIIGINTALEF
DIYGNVNSTHVDGTNMMNGIGGSGDFARNAYISIFVSKSEAKNGAISSVVPMVTHVDHTE
HDVDILVTEQGLADLRGLAPRERAPVIIENCAHPDYRDQLMDYYERACKRGGHTPHLLEE
AFSWHLRRQENGSMRK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgttggaagcacgtatccgtaacagttcactgcgaaacaaggttatcactgcggagcaa
gcggcaagctttatcaaggatggcatgattgttggcatgagcggctttacgcgcgcgggc
gatgccaaggccgttccggtcgccatggccgcgcgggcggcaaccgatccattccagatc
accctgattacaggggcctccctcggacatgacgtcgataaactgttgaccgaagcgcat
attctttctcgccgtatgccgtttcaggccgaccgcacattgcgcagcgcgatcaaccgc
ggcgaagtcatgtttatcgaccagcatctttccgaaacagtcgagcaacttcgttccaac
cagatcggccccatcgactgtgccgtggtagaggcattggcgattaccgaaagcggcgga
atcatcccgacgacttcggtcggcaattcggccagcctcgccattcttgccgaaaaggtt
atcgtcgaggtcaatctgaaccagcccatggcgctggaaggcctgcacgatatttatata
ccgacgaagcgcccttcccgcgatcctatcccgatcatggcttgcgatagccggatcgga
ctgccctatattcccatcgcgccggaaaaaatcgccggtatcgtcatcacgcaggaaaat
gacagtgcgtcacctgtcgagcccgcagatcacgaaacggttgcgattgccgggcatctg
atcgaattcttcaagggggaagtcgtaaagggtcgtctggatctggcgcttaatccattg
caggcgggcatcggcaccattgccaatgcggttttgaccggctttgcagatagtcctttc
cacaatctgcgcatgtatagcgaggtattgcaggatagcacgttcgatctgttcgatgcg
ggcaagctggattttgcctccggctcatcgatcactctcagccccgcttgcggcgagcgc
gttttcaataatatagaccgctatcgtgacaggcttgtcctgcgcccgcaggaaatcagc
aaccatccggaagtcatccgccgtcttggtattatcggcatcaataccgcactcgaattc
gatatctacggcaacgtcaactcaacccatgttgatggaaccaatatgatgaacggcatt
ggcggttccggcgattttgcgcgcaacgcctatatttcgatcttcgtcagcaagtcggaa
gccaagaatggcgcgatctcctcggtcgtgcccatggtaacacatgtggaccacacggaa
catgacgtggatatcctcgtgacggaacagggacttgccgatttgcgcgggcttgcacca
cgcgagcgagcgcccgttatcattgaaaattgcgcacatcccgattaccgggaccagctc
atggattattacgagcgagcctgcaaacgcggcggccacacgcctcatcttctggaagag
gcattcagttggcacctgcgccgtcaggaaaatggcagtatgcgcaaataa

DBGET integrated database retrieval system