KEGG   Brucella pinnipedialis B2/94: BPI_I1502Help
Entry
BPI_I1502         CDS       T01589                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bpp  Brucella pinnipedialis B2/94
Pathway
bpp00670  One carbon pool by folate
bpp01100  Metabolic pathways
bpp01120  Microbial metabolism in diverse environments
bpp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BPI_I1502 (metF)
Enzymes [BR:bpp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     BPI_I1502 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AEK54755
Position
1:complement(1438787..1439701)
Genome map
AA seq 304 aa AA seqDB search
MMGFYGLSRRPDVGQTTRVSFEFFPPKTEEMEQRLWETVTRLAPLQPDFVSVTYGAGGST
RERTVRTVARILKETDIKPAAHLTCVDATREDVDRVAREFAALGVNRFVALRGDPANGIG
EKYVPTPGGYQNGAELVGGLRNIADFDISVSAYPEKHPESPDFATDIDMLKRKVDNGATR
AITQFFFENDLYERYVERVRRAGIYIPIVPGVLPVHNFKQVRNFCARSATHIPAWLAERF
DGLDNDPQTHQLVAAAIAAEQVMDLIERGVQDFHFYTMNRADLPFAICHMIGIRPKTQAA
LEVA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
ttgatgggtttttatggtctttcccgccggccggatgtcggccagaccacccgggtatcg
tttgaattcttccctcccaagacggaagaaatggaacagcgtctctgggaaacggtcacg
cggcttgcgccgctccagcctgatttcgtctccgttacctatggggccggtggctccacg
cgagagcgcacggtgcgcacggtggcccgcattctcaaggaaacagatatcaaacctgcc
gcacatctgacctgcgtggatgcaacacgcgaagatgtggaccgggttgcgcgcgaattt
gcggcgctcggtgtcaatcgttttgtggcgctgcggggtgatccggccaacggtatcggt
gagaaatatgtgccgacgccgggtggctatcagaacggtgccgagctggtcggtggactg
cgcaatattgcggatttcgatatttccgtttcggcctatccggaaaaacacccggaaagc
cccgattttgcaaccgatatcgacatgttgaagcgcaaggtggacaatggcgccacgcgc
gccatcacccagtttttcttcgagaatgatctgtatgagcgttatgtcgagcgcgtacgc
cgtgcaggcatctatattcctatcgttccgggcgtgctgccggtgcataatttcaagcag
gtgcgcaatttctgtgcgcgttcggcaacccatattccggcatggcttgccgaacggttc
gacgggctggataacgatccgcaaacgcatcagctcgtcgcggcggcaattgccgccgag
caggtgatggacctgatcgagcgcggtgtgcaggatttccatttctacacgatgaaccgg
gccgatctgccttttgccatctgtcatatgatcggcataaggccgaagacgcaagcagcc
ctggaggttgcctga

DBGET integrated database retrieval system