KEGG   Brucella pinnipedialis B2/94: BPI_I2189Help
Entry
BPI_I2189         CDS       T01589                                 

Gene name
gshB
Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
bpp  Brucella pinnipedialis B2/94
Pathway
bpp00270  Cysteine and methionine metabolism
bpp00480  Glutathione metabolism
bpp01100  Metabolic pathways
Module
bpp_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:bpp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BPI_I2189 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BPI_I2189 (gshB)
Enzymes [BR:bpp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     BPI_I2189 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AEK55410
Position
1:2086465..2087403
Genome map
AA seq 312 aa AA seqDB search
MALKVAVQMDHISTVNITGDTTFALSLEAQKRGHELFHYTPDRLSMRDGVVSARMEKMEV
RDVKGDHYTLGEPVRRDLTEMDVILLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVR
NSPEKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL
TSLLEMFGQLFREPFIAQRYLKDVRAGDKRIILIDGEPVGALNRVPSETDARSNMHVGGR
PEQSKLTPREREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIERFDGTNI
AALFWDAVEARR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggctctcaaagtcgcggtccagatggaccatatcagcacggtgaacatcacgggcgat
accactttcgctctctcgcttgaggcgcaaaagcgcggccacgagcttttccattatacg
cccgaccggctttccatgcgcgatggcgtggtttccgcccgcatggaaaagatggaagtg
cgcgatgtgaagggcgatcattacacgctgggcgagcctgtccgccgcgacctcacggaa
atggatgtgatcctgctgcgccaggatccgccttttgacatgaattacatcaccacgacg
catcttctggaacgcatccatccaaagacgctggtggtcaacgatccggcctgggtgcgc
aacagcccggaaaagatttttgtcaccgaatttcccgacctgatgccggaaacgctcatc
accaaggatccgcaggaggtgatggatttccgccgtgaattcggcgacatcatcctgaag
ccgctttacggcaatggcggcgcgggcgtcttccatctggcggatggcgaccgcaacctt
acctcgcttctggaaatgttcggccagcttttcagggagccgttcatcgcgcagcgctat
ctgaaagatgtgcgggcgggcgacaagcgtatcatcctcatcgatggcgagccggtgggc
gcgctgaaccgcgtgccgtccgaaaccgacgcacgctccaacatgcatgtgggcggacgc
cccgaacagagcaagttgaccccgcgtgagcgtgaaatctgcgcgcgcattggcccctcg
ctgaaagagcgcggcttcatcctcgtcggcatcgacgtgattggcgactacatgacggaa
atcaacgtgacgtcgccgacaggtatccgtgaaatcgaacgttttgacggcaccaatatt
gccgccctgttctgggatgcggtggaagccagacgataa

DBGET integrated database retrieval system