KEGG   Brucella pinnipedialis B2/94: BPI_II1140Help
Entry
BPI_II1140        CDS       T01589                                 

Gene name
acoC
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase, subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpp  Brucella pinnipedialis B2/94
Pathway
bpp00010  Glycolysis / Gluconeogenesis
bpp00020  Citrate cycle (TCA cycle)
bpp00620  Pyruvate metabolism
bpp01100  Metabolic pathways
bpp01110  Biosynthesis of secondary metabolites
bpp01120  Microbial metabolism in diverse environments
bpp01130  Biosynthesis of antibiotics
bpp01200  Carbon metabolism
Module
bpp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPI_II1140 (acoC)
   00020 Citrate cycle (TCA cycle)
    BPI_II1140 (acoC)
   00620 Pyruvate metabolism
    BPI_II1140 (acoC)
Enzymes [BR:bpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BPI_II1140 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Biotin_lipoyl Abhydrolase_1 E3_binding Hydrolase_4 Biotin_lipoyl_2 RnfC_N HlyD_3 Thioesterase Ser_hydrolase Ndr NQRA HlyD_D23 UPF0227 DUF1100 PAF-AH_p_II
Motif
Other DBs
NCBI-ProteinID: AEK56540
Position
2:1122068..1123354
Genome map
AA seq 428 aa AA seqDB search
MATEILYPKVSLETNSGTISRWHVQDGDAVEQGQILFEIDNDKTVVEVDAPHAGTVKILK
SSTTDEIEVGQSVASLFAKGETITAPPAPAAAQNASAPKTADILAVVNKGQNGRAIATPL
ARRLANDAGIDLDRIGGTGPGGRIQKKDVIAALQSCPSIPETIAASRQARPEGDCLLNAV
WLRKGEGTPLVLLHGFASDHNNWRGLFAGTQWQQPLLAIDLPSHGASPLVAVTSLDAIAA
MIEATLKALDIQRAILVGHSFGAAVSARLANRGNIDIRALGLFSPAGLGPEINVRFVQNF
VRARARESVTPWLHELVHDKASISDTFIKAVVQQRQDNDLSDAMMAFSEHFFADGTQTVS
ILDDLASLEIPVRVIYGRQDRILPFRYTRNLPDNVALYAFDACGHMPHLEKRGLSLRILA
EVSASAAG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccactgaaattctatatccaaaagtcagtctggaaaccaattccggaacgatttcg
cgttggcacgtccaggatggtgacgcggtcgaacagggccagatcctgttcgagatagac
aatgacaagacagtcgtggaggttgatgcgccgcatgccggaacggtaaagatactgaaa
tcttccaccaccgatgaaatcgaggtcggccagagcgtcgccagcctgtttgccaaggga
gaaacgatcaccgcgcctcccgcaccggccgcagcgcaaaatgcatcggcgccaaaaacg
gcggatatattggcggtcgtcaataaaggtcaaaatggcagggccattgcgacacctctt
gccaggcgcctggccaatgatgccgggatcgaccttgaccggatcggcggcaccggccca
ggcgggcgcatccagaagaaggatgtcattgcagcattgcaaagctgcccatccattccc
gaaaccattgctgcttcgaggcaggcgcggccggaaggcgattgcctgcttaatgccgtg
tggctgcgcaagggcgaagggacgccgcttgtgctgttgcacggctttgcctcggaccac
aacaactggcgggggctttttgccggcacacaatggcaacagcccttgctggcgattgat
ctgccctcccatggcgcttccccgctcgtcgccgtcacgagccttgatgcgattgccgcg
atgatcgaggccacactcaaggccctcgatatccagcgtgcgatccttgtgggccattcc
tttggcgcagccgtcagtgctcgccttgccaatcgcggcaatatcgacatccgcgccttg
ggcctgttttcgccagccgggctcggtccggaaatcaatgtcaggttcgtccagaacttc
gttcgggcaagggcgagggaaagtgtgaccccgtggctgcacgagcttgtgcacgacaag
gccagcatttccgatactttcatcaaggccgtcgtgcagcagcgccaggataacgatctg
agcgacgccatgatggcattttccgaacatttcttcgccgacggcacgcagaccgtctcc
attctcgacgatctcgcctcgctcgaaattcccgtccgcgtcatttacggcaggcaggac
aggatattgccgttccgctacacccggaacctgcccgacaatgtcgcgctgtatgcgttc
gatgcttgcgggcacatgccgcatctggaaaagcgcggcctgagcctgcgcatcctggcg
gaggtttccgcctccgcggcaggctga

DBGET integrated database retrieval system