KEGG   Brucella pinnipedialis B2/94: BPI_II172Help
Entry
BPI_II172         CDS       T01589                                 

Gene name
cycA
Definition
(GenBank) cytochrome c2
  KO
K08738  cytochrome c
Organism
bpp  Brucella pinnipedialis B2/94
Pathway
bpp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BPI_II172 (cycA)
 Human Diseases
  Infectious diseases
   05163 Human cytomegalovirus infection
    BPI_II172 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CAP_GLY
Motif
Other DBs
NCBI-ProteinID: AEK55629
Position
2:161024..161419
Genome map
AA seq 131 aa AA seqDB search
MRAAMTAISAIAASLLISTVAQGADIESGKKIFNACKACHQIGEGAKNMVGPELNGLFGR
HSGSVEGYKYSDANKNSGIVWDEEIFRKYIKKPREVIPKTKMVYAGLKDEGKIDDLIAFL
KQYDLGGKIKE
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgcaatgaccgcgatttccgcaatcgcagcttcccttttgatctcgactgtc
gcgcaaggggcggatatcgaatccggcaagaagattttcaacgcatgcaaggcttgccat
cagattggtgagggggcgaaaaatatggtcggccctgagctcaacgggctctttgggcgt
cactcgggttccgtcgaaggatataagtattccgacgcaaacaagaattccggaattgtc
tgggatgaggaaattttccgcaaatacatcaagaagccgcgtgaagtgatcccgaagacc
aagatggtctatgctggcttgaaggatgagggaaagatcgacgacctgattgcatttctc
aagcagtatgatctgggcggcaagatcaaggaataa

DBGET integrated database retrieval system