KEGG   Brucella pinnipedialis B2/94: BPI_II430Help
Entry
BPI_II430         CDS       T01589                                 

Gene name
phbA-2
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpp  Brucella pinnipedialis B2/94
Pathway
bpp00071  Fatty acid degradation
bpp00072  Synthesis and degradation of ketone bodies
bpp00280  Valine, leucine and isoleucine degradation
bpp00310  Lysine degradation
bpp00362  Benzoate degradation
bpp00380  Tryptophan metabolism
bpp00620  Pyruvate metabolism
bpp00630  Glyoxylate and dicarboxylate metabolism
bpp00640  Propanoate metabolism
bpp00650  Butanoate metabolism
bpp00900  Terpenoid backbone biosynthesis
bpp01100  Metabolic pathways
bpp01110  Biosynthesis of secondary metabolites
bpp01120  Microbial metabolism in diverse environments
bpp01130  Biosynthesis of antibiotics
bpp01200  Carbon metabolism
bpp01212  Fatty acid metabolism
bpp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BPI_II430 (phbA-2)
   00630 Glyoxylate and dicarboxylate metabolism
    BPI_II430 (phbA-2)
   00640 Propanoate metabolism
    BPI_II430 (phbA-2)
   00650 Butanoate metabolism
    BPI_II430 (phbA-2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BPI_II430 (phbA-2)
   00072 Synthesis and degradation of ketone bodies
    BPI_II430 (phbA-2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPI_II430 (phbA-2)
   00310 Lysine degradation
    BPI_II430 (phbA-2)
   00380 Tryptophan metabolism
    BPI_II430 (phbA-2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BPI_II430 (phbA-2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPI_II430 (phbA-2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BPI_II430 (phbA-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpp04147]
    BPI_II430 (phbA-2)
Enzymes [BR:bpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BPI_II430 (phbA-2)
Exosome [BR:bpp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BPI_II430 (phbA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEK55875
Position
2:complement(420841..422031)
Genome map
AA seq 396 aa AA seqDB search
MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGAGLAPEAVEEVIMGCVL
PAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAHDLILAGSADVIVAGGMES
MTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTREAQD
AFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVTIDEQPGKAKLDKIPTLRPAFRE
GGTVTAANSSSISDGAAALLLMRASEAEKRGLTPRAVITGHATYADKPNLFSTAPIGAIR
KLSEKTGWDLKDVDLFEINEAFAVVAMAAMRDLDLPHDKVNIHGGACALGHPIGASGARI
LVTLLAALETHGLKRGIAGICLGGGEATAMGIERII
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagcgatcctattgtcatcgtcggtgcttcgcgcacccccatgggcggtttt
cagggtgacttcacaaatgcgcaggcaaccgaccttggcgcttccgccatcggcggcgcg
cttgccggtgcaggccttgccccggaagccgtcgaggaggttatcatgggctgtgtcctg
cctgctggtcagggtcaggcgcctgcgcgtcaggcctcgctcaaggccgggctgccgctt
ggcaccggtgccacgaccgtcaacaagatgtgcggctcgggcatgaaggccgcgatgctt
gcccatgacctcatccttgccggttccgccgatgtcatcgtcgcgggcggcatggaaagc
atgacaaatgccccctatcttctgcccaaggcgcgcgggggctatcgcatgggccatgga
caggtgctcgaccatatgttcctcgatgggctggaagatgcctatgacaaggggcgcctg
atgggcacgtttgcggaagattgcgccgaggcctaccagttcacgcgcgaggcgcaggac
gcatttgcgatatcctccctgacccgcgcgcagaacgcgatcaaggatggtctttttgcg
gcggaaatcacgccggtcaaggtcaagtccggccgcgccgaggtggaagttaccattgac
gagcagccgggcaaggcaaagctggacaagatccccacgctgcgccccgccttccgcgaa
ggcggcacggtaacggcggccaattcctcttccatttccgatggcgcggcagcacttctg
ctcatgcgcgcatcggaggcagaaaaacgtggcctcaccccgcgcgcggtcatcaccggc
cacgcaacctatgccgacaagccaaatctcttctccacggcccccattggcgcgatccgc
aaactgtctgaaaagactggctgggatttgaaggatgtcgatctcttcgagatcaatgaa
gcctttgccgttgttgccatggccgccatgcgcgatcttgacctgccgcacgacaaggtc
aatattcatggcggcgcctgtgcacttggccaccccatcggcgcatcgggcgcacgtatt
ctcgtaaccctgctggcggcacttgaaacacatggcctgaagcgcggcatcgcgggcatc
tgccttggcggcggcgaggcaaccgcaatgggtatcgaaaggatcatctga

DBGET integrated database retrieval system