KEGG   Brucella pinnipedialis B2/94: BPI_II469Help
Entry
BPI_II469         CDS       T01589                                 

Gene name
metA
Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
bpp  Brucella pinnipedialis B2/94
Pathway
bpp00270  Cysteine and methionine metabolism
bpp00920  Sulfur metabolism
bpp01100  Metabolic pathways
bpp01110  Biosynthesis of secondary metabolites
bpp01130  Biosynthesis of antibiotics
bpp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpp00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BPI_II469 (metA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BPI_II469 (metA)
Enzymes [BR:bpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BPI_II469 (metA)
    2.3.1.46  homoserine O-succinyltransferase
     BPI_II469 (metA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AEK55913
Position
2:453522..454442
Genome map
AA seq 306 aa AA seqDB search
MPIKIPDDLPATSVLEAEGVMVMREADAVRQDIRPLRIGLLNLMPNKVTTETQIARLLGA
TPLQVELTLVRMTNHVARHTPADHMLSFYCPWEEVNDQRFDGFVITGAPVERLPFEEVTY
WDEMRRVFDWTQSHVHRTLNICWAAQAAVYHFHGMKKYDLPAKASGVFRQRSLVPASPYL
RGFSDDFAIPVSRWTEVRKSDIPADSGLKVLVDSTETGLCLLDDPRHRSLHMFNHVEYDT
TSLADEYFRDIQVQPEAKVPVNYFPGDDAKRPPENRWRSHAHLLFGNWINEMYQSTPYDI
ERIGKV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattcctgacgatctgcctgcaaccagcgtactcgaagccgagggcgtg
atggtgatgcgtgaggccgatgccgtacgtcaggatattcgtccgctgaggattggcctt
ctcaatctgatgcccaacaaggtaacgaccgagacgcagattgcacgtcttcttggtgcg
acgccgcttcaggtggagctgacgctcgtgcgcatgaccaaccacgtcgcgcgccacaca
ccagccgaccacatgctctccttctattgcccttgggaggaggtgaacgaccaacggttc
gacggttttgtgattaccggcgcgccggtcgagcggctgcccttcgaggaagtcacctac
tgggatgaaatgcggcgcgtatttgactggacgcagagccatgtgcaccgcacgctgaac
atttgctgggccgcgcaggctgcggtctatcatttccacggcatgaaaaaatatgacctg
ccggcaaaagcatcaggggtgttccgccagcgcagtctcgtgccggcatctccttatctg
cgtggtttttcagacgattttgccattccggtttcgcgctggaccgaagtgcgaaagtcc
gacattccggctgatagcgggctgaaggttctggtggacagcaccgaaacgggcctttgc
ctgcttgatgatccgcgccaccgctcgcttcatatgttcaaccatgtcgaatacgacacg
acctcgcttgcagacgaatatttccgcgatattcaggtgcagccggaggcaaaagtacct
gtgaactatttccccggtgatgacgccaagcgcccgccggaaaatcgctggcgcagccat
gcgcatcttcttttcggcaactggatcaacgaaatgtaccagtccacgccctatgatata
gagcggatcggcaaggtctga

DBGET integrated database retrieval system