KEGG   Burkholderia pseudomallei BPC006: BPC006_I0071Help
Entry
BPC006_I0071      CDS       T02301                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00071  Fatty acid degradation
bpq00072  Synthesis and degradation of ketone bodies
bpq00280  Valine, leucine and isoleucine degradation
bpq00310  Lysine degradation
bpq00362  Benzoate degradation
bpq00380  Tryptophan metabolism
bpq00620  Pyruvate metabolism
bpq00630  Glyoxylate and dicarboxylate metabolism
bpq00640  Propanoate metabolism
bpq00650  Butanoate metabolism
bpq00900  Terpenoid backbone biosynthesis
bpq01100  Metabolic pathways
bpq01110  Biosynthesis of secondary metabolites
bpq01120  Microbial metabolism in diverse environments
bpq01130  Biosynthesis of antibiotics
bpq01200  Carbon metabolism
bpq01212  Fatty acid metabolism
bpq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BPC006_I0071
   00630 Glyoxylate and dicarboxylate metabolism
    BPC006_I0071
   00640 Propanoate metabolism
    BPC006_I0071
   00650 Butanoate metabolism
    BPC006_I0071
  Lipid metabolism
   00071 Fatty acid degradation
    BPC006_I0071
   00072 Synthesis and degradation of ketone bodies
    BPC006_I0071
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPC006_I0071
   00310 Lysine degradation
    BPC006_I0071
   00380 Tryptophan metabolism
    BPC006_I0071
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BPC006_I0071
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPC006_I0071
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BPC006_I0071
Enzymes [BR:bpq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BPC006_I0071
Exosome [BR:bpq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BPC006_I0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFR13963
Position
I:68549..70384
Genome map
AA seq 611 aa AA seqDB search
MRPGSAARHGSSAGGGVIDASGSRAAHEAAVRFACARAAWHGVARQPDAVRPPRSARAFA
RHANRLGERAAVRGVAPCVARGIGAAPSGRPNRTAACAELAPTPSGLSSRVCVRDRARHH
EDAPGERAAGGRLGKWCRAGGRTGKARRKHAGKRRSARPSGATGRTRRTSRRPTERRGPS
RSAAAAAVRPGWPSRLAVPTGHLHQPKERFMEAYIFDAVRTPRGKGKKDGSLHGVTPLAL
AATALRAIRDRNGLDTRAVDDVVLGCVEPVGEQGACIGRIAVLAAGYAETTAGVQINRFC
ASGLEACNMAAAQVMSGQSEMAIGGGVESMSRVPMGSSGGAWPVDPAIAIPSYFVPQGVS
ADTIATKWGYSRADVDAYAAESHRRAHAAAQAGWFARSIVPVRDANGLTILDHDETIRPQ
TTPETLATLKPSFAELGEMYGFDAVIRQRYPELERIEHVHHAGNSSGIVDGASAVLIGSL
EAGKRAGLAPRARIRSFASIGSEPSIMLTGPAYAAQKALERAGMRAADIDLYELNEAFAS
VVLRFMDAMAIAHDRINVNGGAIAMGHPLGATGAMILGTLLDELERRGAATGLATLCVGA
GMGTATIIERI
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccggctcggccgcgcgtcacggttcgagcgcgggcggcggcgtgatcgacgcg
agcggttcgcgcgcggcgcacgaagcggcggtgcgattcgcgtgcgcgcgtgcagcgtgg
catggcgtggcgcgccagccggacgcggttcgcccgccgcggtcggctcgggcgttcgcg
cgccatgcgaatcggctcggtgagcgggccgccgtgcggggcgtcgcgccatgcgtcgcg
cggggcatcggggcggcgccgagcggcaggccgaatcgcacggcagcctgcgccgagctc
gcgccaacgccgagcggcttgtcgagccgcgtctgcgtccgcgatcgagcgcggcatcac
gaagacgcaccgggtgaacgcgcggccggcgggcgcttgggcaagtggtgtcgcgccggc
gggcgaaccgggaaggcgcggagaaagcacgccggaaagcgccgatcggcccgcccgagc
ggcgccaccggcagaacccgacgaacgtcgcgccggccgacggagcgacgcgggccgtcc
cgatcggcggcggccgccgccgtccgtcccggctggccgtccagactggccgtcccgacc
ggccatctccatcaaccgaaggaacgattcatggaagcctacattttcgacgccgtgcgc
acgccgcgcggcaaaggcaagaaggacggcagcctgcacggcgtcacgccgctcgcgctc
gccgcaaccgcgctgcgcgcgattcgcgaccgcaacggtctcgacacgcgcgccgtcgac
gacgtcgtgctcggctgcgtcgagcccgtcggcgagcaaggcgcgtgcatcggccgcatc
gcggtgctcgcggccggctacgcggaaaccacggccggcgtgcagatcaaccgcttctgc
gcatcgggcctcgaggcgtgcaacatggccgccgcgcaggtgatgtccggccagtcggag
atggcgatcggcggcggcgtcgagagcatgtcgcgcgtgccgatgggctcgagcggcggc
gcgtggcccgtcgatccggcgatcgcgattccgagctatttcgtgccgcagggcgtatcg
gccgacacgatcgcgacgaagtggggctacagccgtgccgatgtcgacgcgtacgccgcc
gagagccaccgccgcgcgcacgcggcggcgcaggcgggctggttcgcgcgctcgatcgtg
ccggtgcgcgacgcgaacggcctgacgatcctcgatcacgacgagacgatccgcccgcag
acgacgcccgagacgctcgcgacgctcaagccttcgttcgccgaactgggtgagatgtac
ggcttcgacgcggtgatccgccagcgctatccggagctcgaacgcatcgagcacgtgcac
cacgcgggcaacagctcggggatcgtcgacggcgcgtcggccgtgctgatcggctcgctc
gaggcgggcaagcgcgcgggcctcgcgccgcgcgcgcgaatccgctcgttcgcgagcatc
ggctcggagccgtcgatcatgctgacagggccggcctacgcggcgcagaaggcgctcgag
cgcgccggcatgcgcgcggccgacatcgatctgtacgagctgaacgaagcgttcgcgtcg
gtcgtgctgcgcttcatggacgcgatggcgattgcgcacgaccggatcaacgtgaacggc
ggtgcgatcgcgatgggccatccgctcggcgcgacgggcgcgatgatcctcggcacgctg
ctcgacgagctcgagcggcgcggcgcggccacgggccttgcaacgctgtgcgtcggcgcc
ggcatgggcacggcgaccatcatcgaacggatttga

DBGET integrated database retrieval system