KEGG   Burkholderia pseudomallei BPC006: BPC006_I0805Help
Entry
BPC006_I0805      CDS       T02301                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00020  Citrate cycle (TCA cycle)
bpq00640  Propanoate metabolism
bpq00660  C5-Branched dibasic acid metabolism
bpq01100  Metabolic pathways
bpq01110  Biosynthesis of secondary metabolites
bpq01120  Microbial metabolism in diverse environments
bpq01130  Biosynthesis of antibiotics
bpq01200  Carbon metabolism
Module
bpq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPC006_I0805
   00640 Propanoate metabolism
    BPC006_I0805
   00660 C5-Branched dibasic acid metabolism
    BPC006_I0805
Enzymes [BR:bpq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BPC006_I0805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFR14692
Position
I:786045..787211
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAQELGGPVWVVKAQIHAGGRGKGGGV
KVAKSLEQVREYSNQILGMQLKTHQTGPEGQKVNRLLIEEGADIKKELYVGIVIDRVSQK
VVVMASSEGGMDIEEVAEKTPEAIHKVAVEPSVGLQDAEADDLAKKIGVPDASIPQAREI
LKGLYKSFWETDASLAEINPLVLTGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPGLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLNVPLVVRMKGTNEDLGKKM
LAESGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtaccg
cgcggcaagccggcgttctcggtggacgaggccgtcaaggtggcgcaagagctgggcggc
ccggtctgggtcgtcaaggcccagattcatgcgggcggccgcggcaagggcggcggcgtg
aaggtcgcgaagtcgctcgagcaagtgcgcgaatactcgaaccagatcctcggcatgcag
ctgaagacgcaccagacgggcccggaaggccagaaggtcaaccgtctgctgatcgaagaa
ggcgcggacatcaagaaggaactgtatgtcggcatcgtgatcgatcgcgtgtcgcagaag
gtcgtcgtgatggcgtcgagcgaaggcggcatggacatcgaggaagtcgcggaaaagacg
ccggaagcgatccacaaggtcgccgtcgagccatcggtgggcctgcaggatgccgaagcc
gacgatctcgcgaagaagatcggcgtgccggacgcatcgatcccgcaagcgcgcgaaatc
ctgaagggcctgtacaagtcgttctgggaaacggacgcgtcgctcgccgaaatcaacccg
ctcgtgctgacgggcgacggcaaggtgatcgcgctcgacgcgaagttcaacttcgattcg
aacgcgctgttccgccatccggaaatcgtcgcgtaccgcgatctggacgaagaagatccg
gctgaaatcgaagcgtcgaagttcgacctcgcgtacatctcgctcgacggcaacatcggc
tgcctcgtgaacggcgcgggcctggcgatggcgacgatggatacgatcaagctgttcggc
ggcgagccggcgaacttcctcgacgtcggcggcggcgcaacgaccgagaaggtcaccgaa
gcgttcaagctgatgctgaagaacccgggcctgaaggcgatcctcgtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgcgggctcgaaggccgtgaac
ctgaacgtgccgctcgtcgtgcgcatgaagggcacgaacgaagacctcggcaagaagatg
cttgcggaatccggcctgccgatcatctcggcggacagcatggaagaagcggcgcagaag
gtcgtcgccgcggctgcgggcaagtaa

DBGET integrated database retrieval system