KEGG   Burkholderia pseudomallei BPC006: BPC006_I1650
Entry
BPC006_I1650      CDS       T02301                                 

Definition
(GenBank) Rhs element Vgr protein
Organism
bpq  Burkholderia pseudomallei BPC006
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V
Other DBs
NCBI-ProteinID: AFR15526
Position
I:1586894..1589701
AA seq 935 aa
MSVITQFTSLFSAANCLYCLDGPGEIASLQIERWVGRETLSENFQWDVYALATDPGLDLD
AMLGQRVTIRTALANGTSAVRSGLVAQAECIGYDAGLARYCLQLVPWLAALAHGRDERTF
VRQGVADVLGAVFAPYGAIARWRFTADANQRIAELGARDYRVQYRTHTHFDFVRHVLAEA
GLGFCFVEEADAPAGHTMLIFDDSTQLPEDETSARMGGVPQRLSGTATEPDDVIVGIGQS
LSLTADRVTLISSDYRGNQSTSATASLGNPAGSRELYDDVGPEAFDSLREADAAARRHAD
AIVSAARFWTGYGTLRTARAGRALRIAGATWRMSRGGAPAPDAFVLTRVDQIGINNLPAT
VMERVERSLGPLPPANLDARVLAQAKAGGYANRFDAAPRDQAWRPTLEDGTGQRLNPVPT
ALGAQTAIVVGPQGETRPGSTGPVHTDAQGRLRLRYHWQADGDAGTYPTRAMQRLASEGH
GLQQTPRIGHEVLVQFVNGLVHRPIVLGGLFNGRGEGGEAPTPGGEAGQPLDESVYARAS
DHAASAQGNLAGGHSPAWHGAGGGAKRHDHAGALSGFKSQEFDGQGYNQLVADDTDRMGR
MQMATTHAATQLNIGHLRHQADNYLGSFRGQGVELRSDAYGALRGARGVLISSYAPTGPS
QPAGDASALQSLLAQQAALAKLLDKSADTHKTLPFAAQRGAQRAGQSSMNGDAAPLDALG
KSFATTVGADGYAQASADASRRATGNALPHTGDAVLGVEAKGGQGLLAGQSLQWAAGETL
TIGSGNDTNLAVNRTLRVHSGQGIGWLAGANGANGAQGVGMSVIAGKDDLALQAQHDLMA
LRARDDLRVASIGADVEIAAKQTVRLAVSGGAHLTIEGGNVTFGCPGSLVVHAAQHTFVG
PDQLAPALPQFPEKVCVECLKHAMQSGSALAGKAI
NT seq 2808 nt   +upstreamnt  +downstreamnt
atgagcgtgatcacgcaattcacgtcgcttttcagcgctgccaattgtctctattgcctc
gacggtccgggcgaaatcgcgtcgctgcagatcgagcgctgggtggggcgagagacgctc
tccgagaacttccagtgggatgtctacgcgctcgcgaccgatcccggcctcgacctcgac
gcgatgctcgggcagcgcgtgacgatccgcacggcgctcgcgaacggcacgagcgccgtg
cgcagcgggctcgtggcgcaggccgagtgcatcggctacgacgccggcctcgcgcgctac
tgcctgcagctcgtgccgtggctcgccgcgctcgcgcacggccgcgacgagcgcacgttc
gtgcggcagggcgtcgccgacgtgctcggcgcggtgttcgcgccgtacggcgcgatcgcc
cgctggcgcttcaccgcggacgcgaaccagcgcatcgcggaactcggcgcgcgcgactac
cgcgtgcagtaccgcacccacacgcatttcgatttcgtccggcacgtgcttgccgaagcg
ggtctcggcttttgcttcgtcgaggaggcggacgcgcccgcgggccacacgatgctgatc
ttcgacgacagcacgcagttgcccgaggacgagacttccgcgcgcatgggcggcgtgccg
cagcggctgagcggcacggcgaccgagccggacgacgtgatcgtcggcatcgggcagtcg
ctgtcgctgaccgcggatcgcgtcacgctgatcagcagcgactaccgcggcaaccagtcg
acgagcgcgacggcgagcctcggcaatccggccggatcgcgcgagctgtacgacgacgtc
gggccggaggcgttcgacagcctgcgcgaggccgacgccgccgcgcggcggcacgcggac
gcgatcgtctcggcggcgcgcttctggacaggctacggcacgttgcgcaccgcgcgcgcc
ggccgcgcgctgcgcatcgcgggcgcgacgtggcgcatgtcgcgcggcggcgcgccggcg
cccgatgcgttcgtgttgacgcgcgtcgatcagatcggcatcaacaatttgcccgcgacg
gtgatggagcgcgtcgagcgcagcctcggcccgctgccgcccgcgaatctcgacgcgcgc
gtgctcgcgcaggcgaaggcgggcggctatgcgaaccggttcgacgccgcgccgcgcgac
caggcatggcgcccgacgctggaggacggcaccggccagcgactgaacccggtgccgacg
gcgctcggcgcgcagacggcgatcgtcgtcgggccgcagggcgaaacgcggccgggctcg
acgggcccggtgcataccgacgcgcagggccggttgcggctgcgctatcactggcaggcg
gacggcgacgcgggcacctatccgacgcgcgcgatgcagcggctcgcgagcgaggggcac
gggctgcagcagacgccgcggatcggccacgaggtgctcgtgcagttcgtcaacggcctc
gtgcaccggccgatcgtgctcggcgggctgttcaacggccgcggcgagggcggcgaagcg
ccgacgcccggcggcgaagcggggcagccgctcgacgaatcggtctacgcacgggcgagc
gaccacgcggcgagcgcgcaaggcaatcttgcgggcggccatagccccgcgtggcacggc
gcgggcggcggcgcgaagcgccacgatcacgcgggcgcgctgtccggcttcaagagccag
gagttcgacggccagggctacaaccagctcgtcgcggacgataccgatcgcatgggccgc
atgcagatggcgacgacgcacgcggcgacccagctcaacatcggccacttgcggcatcag
gccgacaactatctcggcagcttccgcgggcagggcgtcgagctgcgctcggacgcgtac
ggcgcgctgcgcggcgcgcgcggcgtgctgatctccagctatgcgccgacggggccgtcg
cagccggcgggcgatgcgtcggcgctgcagtcgctgctcgcgcaacaggcggcgctcgcg
aagcttctcgacaaatcggcggacacgcacaagaccttgccgttcgccgcgcagcgtggc
gcgcagcgggccggacagtcgtcgatgaacggcgacgccgcgccgctcgacgcgctcggg
aagagtttcgcgacgacggtcggcgccgacggctacgcgcaggcgtcggccgacgcatcg
cgccgcgcgacgggcaatgcgctgccgcataccggcgacgcggtgctcggcgtcgaggcg
aagggcggccaggggctgctggccggccagtcgctgcaatgggcggcgggcgagacgctg
accatcggcagcggcaacgacaccaacctcgcggtcaaccggacgttgcgcgtgcacagc
gggcagggcatcggctggcttgccggcgcgaacggcgcgaacggcgcgcagggcgtcggc
atgagcgtgatcgccggcaaggacgatctggcgctgcaggcgcagcacgacctgatggcg
ctgcgcgcgcgcgacgatctgagggtcgcgtcgatcggcgcggatgtcgagatcgcggcg
aagcagaccgtgcggctcgcggtcagcggcggcgcgcatctgacgatcgaaggcggcaac
gtcacgttcggctgcccgggctcgctcgtcgttcatgcggcccagcatacgttcgtcggg
ccggatcaactggctcccgcgctgccgcagtttcccgagaaggtgtgcgtcgaatgcctg
aagcacgcgatgcaatcgggcagcgcactggccggcaaggcgatctga

DBGET integrated database retrieval system