KEGG   Burkholderia pseudomallei BPC006: BPC006_I1870Help
Entry
BPC006_I1870      CDS       T02301                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K11066  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bpq  Burkholderia pseudomallei BPC006
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpq01011]
    BPC006_I1870
Enzymes [BR:bpq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     BPC006_I1870
Peptidoglycan biosynthesis and degradation proteins [BR:bpq01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   BPC006_I1870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_2 PG_binding_1 GPP34 PG_binding_2 HTH_Tnp_1
Motif
Other DBs
NCBI-ProteinID: AFR15742
Position
I:1813298..1814197
Genome map
AA seq 299 aa AA seqDB search
MKFPLRHTLLASFSMLAAACTTPTLVNRGDYYADTSLPARSVDSRIRFLVMHYTEIGEAP
SLRVLTQENVSAHYVVPDAPRTERGAPVVYQLVPESERAWHAGVSAWQGATELNGVSIGI
ENVNRGPIDTPHGRMWAPYPPAQVDAIVRLAKDIVARYRIPPTRVVGHSDIAPQRKIDPG
PLFPWRALAKAGVGAWPDDETVAARLAGRSPKSLVDVRELQLKLARYGYDVATDGVLDDR
TRRVFSAFQMHFRPTDYAGNPDAETDAIAQALLDKYMPSQPAPERDAAALDAASGVAAQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcccctgcgccatacgcttctcgcgagcttcagcatgctcgccgccgcctgt
acgacgcccacgctcgtcaatcgcggcgattactacgccgacacgagccttcccgcgcgc
agcgtcgattcgcgcatccgcttcctcgtcatgcactacaccgagatcggcgaagcgccg
tcgctgcgcgtgctgacgcaggagaacgtcagcgcccattacgtcgtgcccgacgcgccg
cgcaccgagcggggcgcgcccgtcgtctatcagctcgtgccggaaagcgagcgcgcatgg
cacgcgggcgtgagcgcgtggcagggcgcgaccgagctgaacggcgtgtcgatcggcatc
gagaacgtcaaccgcggcccgatcgatacgccgcacggccgcatgtgggcgccgtatccg
cccgcgcaggtcgacgcgatcgttcggctggcgaaggatatcgtcgcccgctatcggatt
ccgccgacgcgcgtcgtcggccacagcgacatcgcgccgcagcgcaagatcgatccgggc
ccgctgtttccgtggcgcgcgctcgcgaaggcgggcgtcggcgcgtggccggacgacgag
acggtggccgcgcgcctcgcgggccgctcgccgaagtcgctcgtcgacgtgcgcgagctg
cagctgaagctcgcgcgctacggttacgacgtcgcgacggacggcgtgctcgacgaccgc
acgcggcgcgtgttctccgcgttccagatgcatttccggccgaccgattacgcgggcaac
ccggatgcggagaccgacgcgatcgcgcaggcgctgctcgacaagtacatgccgtcgcag
ccggcgcccgagcgcgatgcggcggcgctcgacgcggcgagcggcgtggccgcccaatga

DBGET integrated database retrieval system