KEGG   Burkholderia pseudomallei BPC006: BPC006_I2540Help
Entry
BPC006_I2540      CDS       T02301                                 

Definition
(GenBank) PII uridylyl-transferase
  KO
K00990  [protein-PII] uridylyltransferase [EC:2.7.7.59]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BPC006_I2540
Enzymes [BR:bpq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.59  [protein-PII] uridylyltransferase
     BPC006_I2540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnD_UR_UTase HD ACT NTP_transf_2 ACT_6 ACT_4 DUF294 Polbeta
Motif
Other DBs
NCBI-ProteinID: AFR16407
Position
I:2477925..2480501
Genome map
AA seq 858 aa AA seqDB search
MSASVAEPPPALSRKAEFKAAKAELLARFKSANHVTPLMHALSRATDDALRSLWQECGLP
ATLALVAVGGFGRGELSPHSDVDILVLLPDAHASELDERIERFIGMAWDLGLEIGSSVRT
VDQCIEEASHDVTVQTSLLEARRIVGSTALFERFMLRYREALDARAFFQAKVLEMRQRHA
KFQDTPYSLEPNVKESPGGLRDLQTILWIARAAGFGSSWRELDTRGLITDREARELRRNE
GFLKTLRARLHVIAGRRQDILVFDLQTQAAESFGYQPTSAKRASEQLMRRYYWAAKAVTQ
LATILIQNIEAQLFPATSGVTRVLSPGRFVEKQGMLEIAADDVFERHPDAILEAFLLYEA
TRGVKGLSARTLRALYNSRDVMNNAWRRDPRNRRTFMQILQQPEGITHAFRLMNQTSVLG
RYLLNFRRIVGQMQHDLYHVYTVDQHILMVLRNIRRFAVAEHAHEYPFCSQLIVNFERPW
VLYVAALFHDIAKGRGGDHSALGMADARRFCREHGIEGDDAALVVWLVQHHLTMSQVAQK
QDTSDPVVIKRFAELVGSERRLTALYLLTVADIRGTSPKVWNTWKGKLLEDLYRATLAVL
GGAQPDAHSELKTRQEEALALLRLETVPPDAHRALWDQLDVGYFLRHDAADIAWQTRVLY
RHVAADTAIVRARPSPVGDALQVLVYVKDRSDLFAGICAYFDRNGLSVLDARVNTTRHGY
ALDNFIVTQTEHDVQYRDIANLVEQQLAARLAESAPLPEPSKGRLSRLSRTFPITPRVDL
RADERGQYYILSVSANDRPGLLYSIARVLAEHRVGVHAARINTLGERVEDVFMLDGTGLS
DNRLQIQVETELLRAIAV
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcatccgtcgccgagccgcctcccgcgctgtcgcgcaaagccgaattcaaggcc
gcgaaggccgagctgctcgcgcgcttcaagagcgcgaaccacgtcacgccgctgatgcac
gcgctgtcgcgcgcgaccgacgacgcgctgcgcagcctgtggcaggaatgcgggctgccc
gcgacgctcgcgctcgtcgcggtcggcggcttcgggcgcggcgagctgtcgccgcactcg
gacgtcgacatcctcgtgctgctgcccgatgcgcacgcgagcgagctcgacgagcgcatc
gagcgcttcatcggcatggcgtgggatctcgggctcgagatcggcagcagcgtgcgcacg
gtcgaccagtgcatcgaggaagcatcgcacgacgtgaccgtgcagacgtcgctgctcgag
gcgcgtcgcatcgtcggcagcacggcgctcttcgagcgcttcatgttgcgctaccgcgag
gcgctcgacgcgcgcgcgttcttccaggcgaaggtgctcgaaatgcgccagcgccacgcg
aagttccaggacacgccgtacagcctcgagccgaacgtgaaggaaagccccggcggcctg
cgcgatctgcagacaatcctctggatcgcgcgcgcggcgggcttcggcagcagctggcgc
gagctcgacacgcgcgggctcatcaccgatcgcgaagcgcgcgagctgcgccgcaacgaa
ggcttcctgaaaacgctgcgcgcgcggctgcacgtgatcgccgggcggcgccaggacatc
ctcgtgttcgatctgcagacgcaggcggccgagagcttcggctaccagccgacgtccgcg
aagcgcgcgagcgagcagctgatgcggcgttactactgggccgcgaaggcggtcacgcag
ctcgcgacgatcctgatccagaacatcgaggcgcagctcttcccggcaacgagcggcgtc
acgcgcgtgctgtcgcccgggcgcttcgtcgagaagcagggcatgctcgagatcgccgcg
gacgacgtgttcgagcgccacccggacgcgatcctcgaagcgttcctgctgtacgaggcg
acgcgcggcgtgaagggcctgtccgcacgcacgctgcgcgcgctctacaactcgcgcgac
gtgatgaacaacgcgtggcggcgcgatccgcgcaaccgccgtacgttcatgcagatcctg
cagcagccggaaggcatcacgcacgcgttccggctgatgaaccagacgagcgtgctcggc
cgctatctgctgaacttccggcgaatcgtcggccagatgcagcacgacctgtaccacgtg
tacacggtcgatcagcatatcctgatggtgctgcgcaacatccgccgcttcgcggtggcc
gagcacgcgcacgaatatccgttctgcagccagctgatcgtgaatttcgagcggccctgg
gtgctgtacgtcgccgccctcttccacgacatcgcgaaaggccgcggcggcgatcactcg
gcgctcgggatggccgacgcgcggcgattctgccgagagcacgggatcgagggcgacgac
gcggcgctcgtcgtctggctcgtccagcatcacctgacgatgagccaggtcgcgcagaag
caggatacgagcgacccggtggtgatcaagcgcttcgcggagctcgtgggcagcgagcgg
cggctgaccgcgctctatctgctgaccgtcgccgatattcgcggcacgagcccgaaggtg
tggaacacgtggaaaggcaagctgctcgaggatctgtatcgcgcgacgctcgccgtgctg
ggcggcgcgcagcccgacgcgcattcggagctgaagacgcgccaggaagaggcgctcgcg
ctgctgcgcctggaaaccgtgccgcccgacgcgcaccgcgcgctgtgggaccagctcgac
gtcggttacttcctgcgccacgatgcggccgacatcgcgtggcagacccgcgtgctgtac
cgccacgtcgcggccgataccgcgatcgtccgcgcgcggccgtcgcccgtcggcgacgcg
ctgcaagtgctcgtctacgtgaaggaccgctcggacctgttcgcgggcatctgcgcgtac
ttcgaccgcaacgggctgtcggtgctcgacgcacgcgtgaacacgacgcgccacggctat
gcgctcgacaatttcatcgtcacgcagaccgagcacgacgtgcaatatcgcgacatcgcg
aacctcgtcgagcagcagctcgccgcacgcctcgccgaatcggcgccgctgcccgagccg
tcgaaggggcggctctcgcggctgtcgcgcacgttcccgatcacgccgcgcgtcgacctg
cgggccgacgagcgcggccagtactacattctgtccgtgtcggcgaacgaccggccgggc
cttctttattcgatcgcgcgcgtgctggccgagcaccgggtcggcgtccacgcggcgcgg
atcaatacgctcggcgaacgcgtcgaggacgtcttcatgctcgacggcaccggcttgtcc
gacaaccgtctgcagatccaagtcgaaaccgagctgctgcgcgcgatcgcagtgtga

DBGET integrated database retrieval system