KEGG   Burkholderia pseudomallei BPC006: BPC006_I2574Help
Entry
BPC006_I2574      CDS       T02301                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00361  Chlorocyclohexane and chlorobenzene degradation
bpq00625  Chloroalkane and chloroalkene degradation
bpq01100  Metabolic pathways
bpq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BPC006_I2574
   00361 Chlorocyclohexane and chlorobenzene degradation
    BPC006_I2574
Enzymes [BR:bpq01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BPC006_I2574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Put_Phosphatase
Motif
Other DBs
NCBI-ProteinID: AFR16441
Position
I:2516245..2517042
Genome map
AA seq 265 aa AA seqDB search
MERNVMPGTPPAFPKAILFDAYGTLFDVHAVVAAAEQLFPGRGDALSQLWRRKQIEYSQL
RTLADPAGGRYRPFWELTLDALRFAARALGLALSAAAEKRLMDEYACLSTYPDTVPTLRA
LRARSTPPKLAILSNGNPQMLDIAVKSAGMSGLFDRVLSVDAVRAYKPSPAAYALGTAAF
DAAPADIAFVSSNGWDVAGAGWFGYRTFWLNRTGAPLEELGAAPAGTGAGMAELLAFLDA
PRAAAKAGGRARPAPRVSRLGAPPT
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtggagcgcaacgtcatgcccggcaccccgcccgccttcccgaaggcgattctcttcgac
gcgtacggcacgctgttcgacgtgcacgcggtcgtcgccgcggccgagcagctgtttccg
gggcgcggcgacgcgctgtcgcagctctggcggcgcaagcagatcgaatattcgcaactg
cgcacgctcgccgatccggcgggcgggcgctatcggccgttctgggagctgacgctcgac
gcgctgcgctttgccgcgcgcgcgctcggcctcgcgctgtccgcggccgccgagaaaaga
ctgatggacgagtatgcgtgcctgtcgacgtacccggacacggtgccgacgctgcgcgcg
ctgcgtgcgcgcagcacgccgccgaagctcgcgatcctgtcgaacggcaatccgcagatg
ctcgatatcgcggtcaagagcgccgggatgagcggcctgttcgaccgcgtgctgtccgtc
gacgcggttcgcgcgtacaagccgtcgcccgccgcgtatgcgctcggcaccgcggcgttc
gacgcggcccccgccgacatcgcgttcgtgtcgtcgaacggctgggacgtcgcgggcgcc
ggctggttcggctaccggaccttctggctgaaccgcacgggcgcgccgctcgaggagctc
ggcgcggcgcccgcgggcacgggcgccggcatggccgaactgctcgcctttctcgacgcg
ccgcgcgccgccgcgaaagcgggcggccgagcgcgcccggcgccccgcgtaagccgcctc
ggcgcgccgccgacctga

DBGET integrated database retrieval system