KEGG   Burkholderia pseudomallei BPC006: BPC006_I2828Help
Entry
BPC006_I2828      CDS       T02301                                 

Definition
(GenBank) histidine ABC transporter, ATP-binding protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BPC006_I2828
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpq02000]
    BPC006_I2828
Enzymes [BR:bpq01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     BPC006_I2828
Transporters [BR:bpq02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BPC006_I2828
   Histidine transporter
    BPC006_I2828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_13 AAA_29 AAA_15 DUF87 AAA_16 AAA_23 APS_kinase AAA_33 PRK G-alpha AAA_28 FtsK_SpoIIIE RYDR_ITPR AAA_22 AAA_24 NACHT
Motif
Other DBs
NCBI-ProteinID: AFR16686
Position
I:complement(2777780..2778574)
Genome map
AA seq 264 aa AA seqDB search
MAETTTTNAACKLEARDIHKRYGDNEVLKGVSLSAKAGDVISIIGASGSGKSTFLRCINF
LERPNAGQIVVDGETVRTKADRAGNLEVADHKQLQRIRTKLAMVFQHFNLWAHMNVLENV
MEAPVHVLGITKREAQERAREYLEKVGLAPRVETQYPSHLSGGQQQRVAIARALAMHPDV
MLFDEPTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRVEEE
GAPADVFGATKSERLKQFLSGSLK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttggcagagaccacgaccacgaatgccgcgtgcaagctcgaggcacgggacatccataag
cgctacggcgacaacgaggtgctcaagggcgtgtcgctgagcgcgaaggcgggcgacgtg
atcagcatcatcggcgcgagcggctcgggcaagagcacgttcctgcgctgcatcaacttt
ctcgagcggccgaacgcgggccagatcgtcgtcgacggcgagacggtgcgcacgaaggcc
gatcgcgcgggcaatctcgaagtcgccgatcacaagcaactgcagcgcatccgcacgaag
ctcgcgatggtgttccagcacttcaatctgtgggcgcacatgaacgtgctggagaacgtg
atggaagcgccggtgcatgtgctggggatcacgaagcgcgaggcgcaggagcgcgcgcgc
gaatatctggagaaggtggggctcgcgccgcgggtggagacgcagtatccgtcgcacctg
tcgggcggccagcagcagcgggtcgcgatcgcgcgcgcgctcgcgatgcacccggacgtg
atgctgttcgacgagccgacgtcggcgctggatccggagctcgtcggcgaagtgctgaag
gtgatgcagaaactggcggaggaagggcgcacgatgatcgtcgtcacgcacgagatgggc
ttcgcgcgcaacgtgtcgaaccacgtgatgttcctgcatcaggggcgcgtcgaggaagaa
ggcgcgcccgccgacgtgttcggcgccacgaagagcgagcgcctgaagcagttcctgtcg
ggcagcctcaagtaa

DBGET integrated database retrieval system