KEGG   Burkholderia pseudomallei BPC006: BPC006_I3007Help
Entry
BPC006_I3007      CDS       T02301                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00970  Aminoacyl-tRNA biosynthesis
bpq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BPC006_I3007
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bpq03029]
    BPC006_I3007
Enzymes [BR:bpq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BPC006_I3007
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BPC006_I3007
Mitochondrial biogenesis [BR:bpq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BPC006_I3007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AFR16860
Position
I:2945336..2947186
Genome map
AA seq 616 aa AA seqDB search
MGHRDATPRTIRHAKRGARRATAALSGGATARAARTASTPRHLDAEPARDSVSMREARER
TRAKRQPHAISHANRGQTRSRRDRPPPAPLRCPPRRPLARPCAVGAASHAKRPRAPPRLR
GATLFYNARTGRRAPSRGFAKRRIVPIRFVNPIEPDTVMTTFAPFPPLARLAADLAAGVT
TSRALVEAALERIADPAGQGALAFTEVDAPRARAAADAHDRLRAAGTVLSPLAGIPVSVK
DLFDVAGQVTRAGSRVLADAPPAADDAVAVARLKRAGAVLVGRTNMSEFAFSGLGLNPHY
GTPRSPYRRDVPGDERIAGGSSSGAAASVADGMAAVALATDTGGSIRIPAALCGLTGFKP
TASRIPKQGGVPLSTTLDSFGPIGVSVACCALVDRILAGLEPHVCAARPLEGVRLGVLTN
YVTDGMDAHVATSLDAALKHLEAAGAIVSDARFAPLDTLPGINRIGFASIEAHAWHRPLV
ARHRDAYDPRVLARILKGEPASAADYLDLVAARAALIDEAARTVWQRFDALVAPTVPIAP
PRIAELERDDDAFARTNALVLRNPSAFNFLDACALSLPCHPRDTAPVGLMLAAAPHHDDA
LLAIGQAVEAVLATIR
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
gtgggccaccgtgacgcgacgccgcgcaccattcggcatgcgaagcgaggcgcgcggcgc
gcaacagcagcgctcagcggcggcgcgacagcgcgcgccgcgcggacggcttcgacgccg
cgacacctcgacgccgagcccgcgcgcgattccgtatcgatgcgcgaggcgcgcgaacgg
acgcgcgcgaaacgacagccgcatgcgatatcgcacgcgaaccgcggtcaaacgcgttcc
cgtcgcgatcgaccgccccccgcgccccttcgttgcccgccccgacgtccgctcgcgcgg
ccgtgcgccgtcggcgccgcgtcgcatgcgaagcgcccgcgcgcgccgccgcgcctccgc
ggcgcaacgctgttctacaatgcgcgaaccggccgccgagcgccatcgcgcggcttcgcg
aagcgccgaatcgtgccgatccgcttcgtcaacccgatcgaacccgataccgtcatgacc
actttcgcccccttcccgccgctcgcccgcctcgccgccgatctcgccgccggcgtgacg
acgagccgcgcgctcgtcgaagccgcgctcgaacggatcgccgatccggcggggcaaggc
gcgctcgcgttcaccgaggtcgacgcgccgcgcgcgcgcgcggccgccgacgcgcacgat
cgcctgcgcgcggcgggcaccgtgctgtcaccgctcgcgggcattccggtgtcggtgaag
gatctgttcgacgtcgcgggccaggtcacgcgcgcgggctcccgcgtgctcgccgacgcg
cccccggccgccgacgacgccgtcgcggtcgcccgcctcaagcgcgcgggcgccgtgctc
gtcggccgcacgaacatgagcgaattcgcgttctccggcctgggcctcaatccgcattac
ggcacgccgcgctcgccgtaccggcgcgacgtgccgggcgacgagcggatcgcgggcggc
tcgtcgtcgggcgcggccgcatcggttgcggacggcatggcggccgtcgcgctcgcgacc
gatacgggcggctcgatccgcatccccgccgcgctctgcggactgacgggcttcaagccg
accgcgagccggattccgaagcaaggcggcgtgccgctgtcgacgacgctcgattcgttc
ggcccgatcggcgtatcggtcgcgtgctgcgcgctcgtcgaccggatcctcgcgggcctc
gagccgcacgtgtgcgccgcgcgcccgctcgagggcgtgcggctcggcgtgctgacgaac
tatgtgacggacggcatggacgcgcacgtcgccacgtcgctcgacgccgcgctcaagcat
ctggaagcggcgggcgcgatcgtgtcggacgcgcgcttcgcgccgctcgacacgctgccc
ggcatcaaccgcatcggtttcgcttcgatcgaggcgcatgcgtggcatcgcccgctcgtc
gcgcgccaccgcgacgcgtacgatccgcgcgtgctcgcgcgcatcctgaagggcgagccg
gcgagcgccgccgattacctcgatctcgtcgccgcgcgcgcggcgctcatcgacgaggcg
gcgcgcaccgtgtggcagcgcttcgatgcgctcgtcgcgccgacggtgcccatcgcgccg
ccgcgcatcgccgagctcgaacgggacgacgacgcgttcgcccgcacgaacgcgctcgtg
ctgcgcaacccgagcgcgttcaattttctcgatgcgtgcgcgctatcgctgccgtgccat
ccgcgcgacacggcgcccgtcggcctgatgctcgccgccgcaccgcatcacgacgacgcg
ctgctcgcgatcggccaggcggtcgaagcggtgctcgcgacgatccgctga

DBGET integrated database retrieval system